Cargando…
A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 D...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3721206/ https://www.ncbi.nlm.nih.gov/pubmed/23708186 http://dx.doi.org/10.3390/md11061800 |
_version_ | 1782278045453778944 |
---|---|
author | Chen, Lili Song, Liyan Li, Tingfei Zhu, Jianhua Xu, Jian Zheng, Qin Yu, Rongmin |
author_facet | Chen, Lili Song, Liyan Li, Tingfei Zhu, Jianhua Xu, Jian Zheng, Qin Yu, Rongmin |
author_sort | Chen, Lili |
collection | PubMed |
description | A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNHDGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRKNNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC(50) values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively. |
format | Online Article Text |
id | pubmed-3721206 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-37212062013-07-24 A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata Chen, Lili Song, Liyan Li, Tingfei Zhu, Jianhua Xu, Jian Zheng, Qin Yu, Rongmin Mar Drugs Article A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNHDGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRKNNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC(50) values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively. MDPI 2013-05-24 /pmc/articles/PMC3721206/ /pubmed/23708186 http://dx.doi.org/10.3390/md11061800 Text en © 2013 by the authors; licensee MDPI, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0/ This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Article Chen, Lili Song, Liyan Li, Tingfei Zhu, Jianhua Xu, Jian Zheng, Qin Yu, Rongmin A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata |
title | A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata |
title_full | A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata |
title_fullStr | A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata |
title_full_unstemmed | A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata |
title_short | A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata |
title_sort | new antiproliferative and antioxidant peptide isolated from arca subcrenata |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3721206/ https://www.ncbi.nlm.nih.gov/pubmed/23708186 http://dx.doi.org/10.3390/md11061800 |
work_keys_str_mv | AT chenlili anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT songliyan anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT litingfei anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT zhujianhua anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT xujian anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT zhengqin anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT yurongmin anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT chenlili newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT songliyan newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT litingfei newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT zhujianhua newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT xujian newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT zhengqin newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata AT yurongmin newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata |