Cargando…

A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata

A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 D...

Descripción completa

Detalles Bibliográficos
Autores principales: Chen, Lili, Song, Liyan, Li, Tingfei, Zhu, Jianhua, Xu, Jian, Zheng, Qin, Yu, Rongmin
Formato: Online Artículo Texto
Lenguaje:English
Publicado: MDPI 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3721206/
https://www.ncbi.nlm.nih.gov/pubmed/23708186
http://dx.doi.org/10.3390/md11061800
_version_ 1782278045453778944
author Chen, Lili
Song, Liyan
Li, Tingfei
Zhu, Jianhua
Xu, Jian
Zheng, Qin
Yu, Rongmin
author_facet Chen, Lili
Song, Liyan
Li, Tingfei
Zhu, Jianhua
Xu, Jian
Zheng, Qin
Yu, Rongmin
author_sort Chen, Lili
collection PubMed
description A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNHDGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRKNNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC(50) values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively.
format Online
Article
Text
id pubmed-3721206
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher MDPI
record_format MEDLINE/PubMed
spelling pubmed-37212062013-07-24 A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata Chen, Lili Song, Liyan Li, Tingfei Zhu, Jianhua Xu, Jian Zheng, Qin Yu, Rongmin Mar Drugs Article A new antitumor and antioxidant peptide (H3) was isolated from Arca subcrenata Lischke using ion exchange and hydrophobic column chromatography. The purity of H3 was over 99.3% in reversed phase-high performance liquid chromatography (RP-HPLC) and the molecular weight was determined to be 20,491.0 Da by electrospray-ionization mass spectrometry (ESI-MS/MS). The isoelectric point of H3 was measured to be 6.65 by isoelectric focusing-polyacrylamide gel electrophoresis. Partial amino acid sequence of this peptide was determined as ISMEDVEESRKNGMHSIDVNHDGKHRAYWADNTYLM-KCMDLPYDVLDTGGKDRSSDKNTDLVDLFELDMVPDRKNNECMNMIMDVIDTN-TAARPYYCSLDVNHDGAGLSMEDVEEDK via MALDI-TOF/TOF-MS and de novo sequencing. The in vitro antitumor activity of H3 was evaluated by 3-(4,5-dimethyl-2-thiazolyl)-2,5-diphenyl-2H-tetrazolium bromide (MTT) assay. The result indicated that H3 exhibited significant antiproliferative activity against HeLa, HepG2 and HT-29 cell lines with IC(50) values of 10.8, 10.1 and 10.5 μg/mL. The scavenging percentage of H3 at 8 mg/mL to 2,2-diphenyl-1-picrylhydrazyl (DPPH) and hydroxyl radicals were 56.8% and 47.5%, respectively. MDPI 2013-05-24 /pmc/articles/PMC3721206/ /pubmed/23708186 http://dx.doi.org/10.3390/md11061800 Text en © 2013 by the authors; licensee MDPI, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0/ This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/).
spellingShingle Article
Chen, Lili
Song, Liyan
Li, Tingfei
Zhu, Jianhua
Xu, Jian
Zheng, Qin
Yu, Rongmin
A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
title A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
title_full A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
title_fullStr A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
title_full_unstemmed A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
title_short A New Antiproliferative and Antioxidant Peptide Isolated from Arca subcrenata
title_sort new antiproliferative and antioxidant peptide isolated from arca subcrenata
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3721206/
https://www.ncbi.nlm.nih.gov/pubmed/23708186
http://dx.doi.org/10.3390/md11061800
work_keys_str_mv AT chenlili anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT songliyan anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT litingfei anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT zhujianhua anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT xujian anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT zhengqin anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT yurongmin anewantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT chenlili newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT songliyan newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT litingfei newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT zhujianhua newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT xujian newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT zhengqin newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata
AT yurongmin newantiproliferativeandantioxidantpeptideisolatedfromarcasubcrenata