Cargando…
Deep Sea Water Modulates Blood Pressure and Exhibits Hypolipidemic Effects via the AMPK-ACC Pathway: An in Vivo Study
Deep sea water (DSW), originally pumped from the Pacific Rim off the coast of Hualien County (Taiwan), and its mineral constituents, were concentrated by a low-temperature vacuum evaporation system to produce a hardness of approximately 400,000 mg/L of seawater mineral concentrate. The primary compo...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3721228/ https://www.ncbi.nlm.nih.gov/pubmed/23774889 http://dx.doi.org/10.3390/md11062183 |
_version_ | 1782278050426126336 |
---|---|
author | Sheu, Ming-Jyh Chou, Pei-Yu Lin, Wen-Hsin Pan, Chun-Hsu Chien, Yi-Chung Chung, Yun-Lung Liu, Fon-Chang Wu, Chieh-Hsi |
author_facet | Sheu, Ming-Jyh Chou, Pei-Yu Lin, Wen-Hsin Pan, Chun-Hsu Chien, Yi-Chung Chung, Yun-Lung Liu, Fon-Chang Wu, Chieh-Hsi |
author_sort | Sheu, Ming-Jyh |
collection | PubMed |
description | Deep sea water (DSW), originally pumped from the Pacific Rim off the coast of Hualien County (Taiwan), and its mineral constituents, were concentrated by a low-temperature vacuum evaporation system to produce a hardness of approximately 400,000 mg/L of seawater mineral concentrate. The primary composition of this seawater mineral concentrate was ionic magnesium (Mg(2+)), which was approximately 96,000 mg/L. Referring to the human recommended daily allowance (RDA) of magnesium, we diluted the mineral concentrate to three different dosages: 0.1 × DSW (equivalent to 3.75 mg Mg(2+)/kg DSW); 1 × DSW (equivalent to 37.5 mg Mg(2+)/kg DSW); and 2 × DSW (equivalent to 75 mg Mg(2+)/kg DSW). Additionally, a magnesium chloride treatment was conducted for comparison with the DSW supplement. The study indicated that 0.1 × DSW, 1 × DSW and 2 × DSW decreased the systolic and diastolic pressures in spontaneous hypertensive rats in an eight-week experiment. DSW has been shown to reduce serum lipids and prevent atherogenesis in a hypercholesterolemic rabbit model. Our results demonstrated that 1 × DSW and 2 × DSW significantly suppressed the serum cholesterol levels, reduced the lipid accumulation in liver tissues, and limited aortic fatty streaks. These findings indicated that the antiatherogenic effects of DSW are associated with 5′-adenosine monophosphate-activated protein kinase (AMPK) stimulation and the consequent inhibition of phosphorylation of acetyl-CoA carboxylase (ACC) in atherosclerotic rabbits. We hypothesize that DSW could potentially be used as drinking water because it modulates blood pressure, reduces lipids, and prevents atherogenesis. |
format | Online Article Text |
id | pubmed-3721228 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-37212282013-07-24 Deep Sea Water Modulates Blood Pressure and Exhibits Hypolipidemic Effects via the AMPK-ACC Pathway: An in Vivo Study Sheu, Ming-Jyh Chou, Pei-Yu Lin, Wen-Hsin Pan, Chun-Hsu Chien, Yi-Chung Chung, Yun-Lung Liu, Fon-Chang Wu, Chieh-Hsi Mar Drugs Article Deep sea water (DSW), originally pumped from the Pacific Rim off the coast of Hualien County (Taiwan), and its mineral constituents, were concentrated by a low-temperature vacuum evaporation system to produce a hardness of approximately 400,000 mg/L of seawater mineral concentrate. The primary composition of this seawater mineral concentrate was ionic magnesium (Mg(2+)), which was approximately 96,000 mg/L. Referring to the human recommended daily allowance (RDA) of magnesium, we diluted the mineral concentrate to three different dosages: 0.1 × DSW (equivalent to 3.75 mg Mg(2+)/kg DSW); 1 × DSW (equivalent to 37.5 mg Mg(2+)/kg DSW); and 2 × DSW (equivalent to 75 mg Mg(2+)/kg DSW). Additionally, a magnesium chloride treatment was conducted for comparison with the DSW supplement. The study indicated that 0.1 × DSW, 1 × DSW and 2 × DSW decreased the systolic and diastolic pressures in spontaneous hypertensive rats in an eight-week experiment. DSW has been shown to reduce serum lipids and prevent atherogenesis in a hypercholesterolemic rabbit model. Our results demonstrated that 1 × DSW and 2 × DSW significantly suppressed the serum cholesterol levels, reduced the lipid accumulation in liver tissues, and limited aortic fatty streaks. These findings indicated that the antiatherogenic effects of DSW are associated with 5′-adenosine monophosphate-activated protein kinase (AMPK) stimulation and the consequent inhibition of phosphorylation of acetyl-CoA carboxylase (ACC) in atherosclerotic rabbits. We hypothesize that DSW could potentially be used as drinking water because it modulates blood pressure, reduces lipids, and prevents atherogenesis. MDPI 2013-06-17 /pmc/articles/PMC3721228/ /pubmed/23774889 http://dx.doi.org/10.3390/md11062183 Text en © 2013 by the authors; licensee MDPI, Basel, Switzerland. http://creativecommons.org/licenses/by/3.0/ This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Article Sheu, Ming-Jyh Chou, Pei-Yu Lin, Wen-Hsin Pan, Chun-Hsu Chien, Yi-Chung Chung, Yun-Lung Liu, Fon-Chang Wu, Chieh-Hsi Deep Sea Water Modulates Blood Pressure and Exhibits Hypolipidemic Effects via the AMPK-ACC Pathway: An in Vivo Study |
title | Deep Sea Water Modulates Blood Pressure and Exhibits Hypolipidemic Effects via the AMPK-ACC Pathway: An in Vivo Study |
title_full | Deep Sea Water Modulates Blood Pressure and Exhibits Hypolipidemic Effects via the AMPK-ACC Pathway: An in Vivo Study |
title_fullStr | Deep Sea Water Modulates Blood Pressure and Exhibits Hypolipidemic Effects via the AMPK-ACC Pathway: An in Vivo Study |
title_full_unstemmed | Deep Sea Water Modulates Blood Pressure and Exhibits Hypolipidemic Effects via the AMPK-ACC Pathway: An in Vivo Study |
title_short | Deep Sea Water Modulates Blood Pressure and Exhibits Hypolipidemic Effects via the AMPK-ACC Pathway: An in Vivo Study |
title_sort | deep sea water modulates blood pressure and exhibits hypolipidemic effects via the ampk-acc pathway: an in vivo study |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3721228/ https://www.ncbi.nlm.nih.gov/pubmed/23774889 http://dx.doi.org/10.3390/md11062183 |
work_keys_str_mv | AT sheumingjyh deepseawatermodulatesbloodpressureandexhibitshypolipidemiceffectsviatheampkaccpathwayaninvivostudy AT choupeiyu deepseawatermodulatesbloodpressureandexhibitshypolipidemiceffectsviatheampkaccpathwayaninvivostudy AT linwenhsin deepseawatermodulatesbloodpressureandexhibitshypolipidemiceffectsviatheampkaccpathwayaninvivostudy AT panchunhsu deepseawatermodulatesbloodpressureandexhibitshypolipidemiceffectsviatheampkaccpathwayaninvivostudy AT chienyichung deepseawatermodulatesbloodpressureandexhibitshypolipidemiceffectsviatheampkaccpathwayaninvivostudy AT chungyunlung deepseawatermodulatesbloodpressureandexhibitshypolipidemiceffectsviatheampkaccpathwayaninvivostudy AT liufonchang deepseawatermodulatesbloodpressureandexhibitshypolipidemiceffectsviatheampkaccpathwayaninvivostudy AT wuchiehhsi deepseawatermodulatesbloodpressureandexhibitshypolipidemiceffectsviatheampkaccpathwayaninvivostudy |