Cargando…
Identification and Characterization of the Spodoptera Su(var) 3-9 Histone H3K9 trimethyltransferase and Its Effect in AcMNPV Infection
Histone H3-lysine(9) (H3K9) trimethyltransferase gene Su(var) 3-9 was cloned and identified in three Spodoptera insects, Spodoptera frugiperda ( S . frugiperda ), S . exigua and S . litura . Sequence analysis showed that Spodoptera Su(var) 3-9 is highly conserved evolutionarily. Su(var) 3-9 protein...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3722159/ https://www.ncbi.nlm.nih.gov/pubmed/23894480 http://dx.doi.org/10.1371/journal.pone.0069442 |
_version_ | 1782278153775874048 |
---|---|
author | Li, Binbin Li, Sisi Yin, Juan Zhong, Jiang |
author_facet | Li, Binbin Li, Sisi Yin, Juan Zhong, Jiang |
author_sort | Li, Binbin |
collection | PubMed |
description | Histone H3-lysine(9) (H3K9) trimethyltransferase gene Su(var) 3-9 was cloned and identified in three Spodoptera insects, Spodoptera frugiperda ( S . frugiperda ), S . exigua and S . litura . Sequence analysis showed that Spodoptera Su(var) 3-9 is highly conserved evolutionarily. Su(var) 3-9 protein was found to be localized in the nucleus in Sf9 cells, and interact with histone H3, and the heterochromatin protein 1a (HP1a) and HP1b. A dose-dependent enzymatic activity was found at both 27 °C and 37 °C in vitro, with higher activity at 27 °C. Addition of specific inhibitor chaetocin resulted in decreased histone methylation level and host chromatin relaxation. In contrast, overexpression of Su(var) 3-9 caused increased histone methylation level and cellular genome compaction. In AcMNV-infected Sf9 cells, the transcription of Su(var) 3-9 increased at late time of infection, although the mRNA levels of most cellular genes decreased. Pre-treatment of Sf9 cells with chaetocin speeded up viral DNA replication, and increased the transcription level of a variety of virus genes, whereas in Sf9 cells pre-transformed with Su(var) 3-9 expression vector, viral DNA replication slow down slightly. These findings suggest that Su(var) 3-9 might participate in the viral genes expression an genome replication repression during AcMNPV infection. It provided a new insight for the understanding virus–host interaction mechanism. |
format | Online Article Text |
id | pubmed-3722159 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-37221592013-07-26 Identification and Characterization of the Spodoptera Su(var) 3-9 Histone H3K9 trimethyltransferase and Its Effect in AcMNPV Infection Li, Binbin Li, Sisi Yin, Juan Zhong, Jiang PLoS One Research Article Histone H3-lysine(9) (H3K9) trimethyltransferase gene Su(var) 3-9 was cloned and identified in three Spodoptera insects, Spodoptera frugiperda ( S . frugiperda ), S . exigua and S . litura . Sequence analysis showed that Spodoptera Su(var) 3-9 is highly conserved evolutionarily. Su(var) 3-9 protein was found to be localized in the nucleus in Sf9 cells, and interact with histone H3, and the heterochromatin protein 1a (HP1a) and HP1b. A dose-dependent enzymatic activity was found at both 27 °C and 37 °C in vitro, with higher activity at 27 °C. Addition of specific inhibitor chaetocin resulted in decreased histone methylation level and host chromatin relaxation. In contrast, overexpression of Su(var) 3-9 caused increased histone methylation level and cellular genome compaction. In AcMNV-infected Sf9 cells, the transcription of Su(var) 3-9 increased at late time of infection, although the mRNA levels of most cellular genes decreased. Pre-treatment of Sf9 cells with chaetocin speeded up viral DNA replication, and increased the transcription level of a variety of virus genes, whereas in Sf9 cells pre-transformed with Su(var) 3-9 expression vector, viral DNA replication slow down slightly. These findings suggest that Su(var) 3-9 might participate in the viral genes expression an genome replication repression during AcMNPV infection. It provided a new insight for the understanding virus–host interaction mechanism. Public Library of Science 2013-07-24 /pmc/articles/PMC3722159/ /pubmed/23894480 http://dx.doi.org/10.1371/journal.pone.0069442 Text en © 2013 Li et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Li, Binbin Li, Sisi Yin, Juan Zhong, Jiang Identification and Characterization of the Spodoptera Su(var) 3-9 Histone H3K9 trimethyltransferase and Its Effect in AcMNPV Infection |
title | Identification and Characterization of the
Spodoptera
Su(var) 3-9 Histone H3K9 trimethyltransferase and Its Effect in AcMNPV Infection |
title_full | Identification and Characterization of the
Spodoptera
Su(var) 3-9 Histone H3K9 trimethyltransferase and Its Effect in AcMNPV Infection |
title_fullStr | Identification and Characterization of the
Spodoptera
Su(var) 3-9 Histone H3K9 trimethyltransferase and Its Effect in AcMNPV Infection |
title_full_unstemmed | Identification and Characterization of the
Spodoptera
Su(var) 3-9 Histone H3K9 trimethyltransferase and Its Effect in AcMNPV Infection |
title_short | Identification and Characterization of the
Spodoptera
Su(var) 3-9 Histone H3K9 trimethyltransferase and Its Effect in AcMNPV Infection |
title_sort | identification and characterization of the
spodoptera
su(var) 3-9 histone h3k9 trimethyltransferase and its effect in acmnpv infection |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3722159/ https://www.ncbi.nlm.nih.gov/pubmed/23894480 http://dx.doi.org/10.1371/journal.pone.0069442 |
work_keys_str_mv | AT libinbin identificationandcharacterizationofthespodopterasuvar39histoneh3k9trimethyltransferaseanditseffectinacmnpvinfection AT lisisi identificationandcharacterizationofthespodopterasuvar39histoneh3k9trimethyltransferaseanditseffectinacmnpvinfection AT yinjuan identificationandcharacterizationofthespodopterasuvar39histoneh3k9trimethyltransferaseanditseffectinacmnpvinfection AT zhongjiang identificationandcharacterizationofthespodopterasuvar39histoneh3k9trimethyltransferaseanditseffectinacmnpvinfection |