Cargando…
Bioinformatics and Gene Network Analyses of the Swine Mammary Gland Transcriptome during Late Gestation
We used the newly-developed Dynamic Impact Approach (DIA) and gene network analysis to study the sow mammary transcriptome at 80, 100, and 110 days of pregnancy. A swine oligoarray with 13,290 inserts was used for transcriptome profiling. An ANOVA with false discovery rate (FDR < 0.15) correction...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Libertas Academica
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3728096/ https://www.ncbi.nlm.nih.gov/pubmed/23908586 http://dx.doi.org/10.4137/BBI.S12205 |
_version_ | 1782278804853489664 |
---|---|
author | Zhao, Wangsheng Shahzad, Khuram Jiang, Mingfeng Graugnard, Daniel E. Rodriguez-Zas, Sandra L. Luo, Jun Loor, Juan J. Hurley, Walter L. |
author_facet | Zhao, Wangsheng Shahzad, Khuram Jiang, Mingfeng Graugnard, Daniel E. Rodriguez-Zas, Sandra L. Luo, Jun Loor, Juan J. Hurley, Walter L. |
author_sort | Zhao, Wangsheng |
collection | PubMed |
description | We used the newly-developed Dynamic Impact Approach (DIA) and gene network analysis to study the sow mammary transcriptome at 80, 100, and 110 days of pregnancy. A swine oligoarray with 13,290 inserts was used for transcriptome profiling. An ANOVA with false discovery rate (FDR < 0.15) correction resulted in 1,409 genes with a significant time effect across time comparisons. The DIA uncovered that Fatty acid biosynthesis, Interleukin-4 receptor binding, Galactose metabolism, and mTOR signaling were among the most-impacted pathways. IL-4 receptor binding, ABC transporters, cytokine-cytokine receptor interaction, and Jak-STAT signaling were markedly activated at 110 days compared with 80 and 100 days. Epigenetic and transcription factor regulatory mechanisms appear important in coordinating the final stages of mammary development during pregnancy. Network analysis revealed a crucial role for TP53, ARNT2, E2F4, and PPARG. The bioinformatics analyses revealed a number of pathways and functions that perform an irreplaceable role during late gestation to farrowing. |
format | Online Article Text |
id | pubmed-3728096 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Libertas Academica |
record_format | MEDLINE/PubMed |
spelling | pubmed-37280962013-08-01 Bioinformatics and Gene Network Analyses of the Swine Mammary Gland Transcriptome during Late Gestation Zhao, Wangsheng Shahzad, Khuram Jiang, Mingfeng Graugnard, Daniel E. Rodriguez-Zas, Sandra L. Luo, Jun Loor, Juan J. Hurley, Walter L. Bioinform Biol Insights Original Research We used the newly-developed Dynamic Impact Approach (DIA) and gene network analysis to study the sow mammary transcriptome at 80, 100, and 110 days of pregnancy. A swine oligoarray with 13,290 inserts was used for transcriptome profiling. An ANOVA with false discovery rate (FDR < 0.15) correction resulted in 1,409 genes with a significant time effect across time comparisons. The DIA uncovered that Fatty acid biosynthesis, Interleukin-4 receptor binding, Galactose metabolism, and mTOR signaling were among the most-impacted pathways. IL-4 receptor binding, ABC transporters, cytokine-cytokine receptor interaction, and Jak-STAT signaling were markedly activated at 110 days compared with 80 and 100 days. Epigenetic and transcription factor regulatory mechanisms appear important in coordinating the final stages of mammary development during pregnancy. Network analysis revealed a crucial role for TP53, ARNT2, E2F4, and PPARG. The bioinformatics analyses revealed a number of pathways and functions that perform an irreplaceable role during late gestation to farrowing. Libertas Academica 2013-07-14 /pmc/articles/PMC3728096/ /pubmed/23908586 http://dx.doi.org/10.4137/BBI.S12205 Text en © 2013 the author(s), publisher and licensee Libertas Academica Ltd. This is an open access article published under the Creative Commons CC-BY-NC 3.0 license. |
spellingShingle | Original Research Zhao, Wangsheng Shahzad, Khuram Jiang, Mingfeng Graugnard, Daniel E. Rodriguez-Zas, Sandra L. Luo, Jun Loor, Juan J. Hurley, Walter L. Bioinformatics and Gene Network Analyses of the Swine Mammary Gland Transcriptome during Late Gestation |
title | Bioinformatics and Gene Network Analyses of the Swine Mammary Gland Transcriptome during Late Gestation |
title_full | Bioinformatics and Gene Network Analyses of the Swine Mammary Gland Transcriptome during Late Gestation |
title_fullStr | Bioinformatics and Gene Network Analyses of the Swine Mammary Gland Transcriptome during Late Gestation |
title_full_unstemmed | Bioinformatics and Gene Network Analyses of the Swine Mammary Gland Transcriptome during Late Gestation |
title_short | Bioinformatics and Gene Network Analyses of the Swine Mammary Gland Transcriptome during Late Gestation |
title_sort | bioinformatics and gene network analyses of the swine mammary gland transcriptome during late gestation |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3728096/ https://www.ncbi.nlm.nih.gov/pubmed/23908586 http://dx.doi.org/10.4137/BBI.S12205 |
work_keys_str_mv | AT zhaowangsheng bioinformaticsandgenenetworkanalysesoftheswinemammaryglandtranscriptomeduringlategestation AT shahzadkhuram bioinformaticsandgenenetworkanalysesoftheswinemammaryglandtranscriptomeduringlategestation AT jiangmingfeng bioinformaticsandgenenetworkanalysesoftheswinemammaryglandtranscriptomeduringlategestation AT graugnarddaniele bioinformaticsandgenenetworkanalysesoftheswinemammaryglandtranscriptomeduringlategestation AT rodriguezzassandral bioinformaticsandgenenetworkanalysesoftheswinemammaryglandtranscriptomeduringlategestation AT luojun bioinformaticsandgenenetworkanalysesoftheswinemammaryglandtranscriptomeduringlategestation AT loorjuanj bioinformaticsandgenenetworkanalysesoftheswinemammaryglandtranscriptomeduringlategestation AT hurleywalterl bioinformaticsandgenenetworkanalysesoftheswinemammaryglandtranscriptomeduringlategestation |