Cargando…

An Inhibitor of the δPKC Interaction with the d Subunit of F(1)Fo ATP Synthase Reduces Cardiac Troponin I Release from Ischemic Rat Hearts: Utility of a Novel Ammonium Sulfate Precipitation Technique

We have previously reported protection against hypoxic injury by a cell-permeable, mitochondrially-targeted δPKC-d subunit of F(1)Fo ATPase (dF(1)Fo) interaction inhibitor [NH(2)-YGRKKRRQRRRMLA TRALSLIGKRAISTSVCAGRKLALKTIDWVSFDYKDDDDK-COOH] in neonatal cardiac myo-cytes. In the present work we demon...

Descripción completa

Detalles Bibliográficos
Autores principales:	Ogbi, Mourad, Obi, Ijeoma, Johnson, John A.
Formato:	Online Artículo Texto
Lenguaje:	English
Publicado:	Public Library of Science 2013
Materias:	Research Article
Acceso en línea:	https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3731279/ https://www.ncbi.nlm.nih.gov/pubmed/23936451 http://dx.doi.org/10.1371/journal.pone.0070580

Ejemplares similares

Deregulation of mitochondrial F1FO-ATP synthase via OSCP in Alzheimer’s disease
por: Beck, Simon J., et al.
Publicado: (2016)

The δ subunit of F(1)F(o)-ATP synthase is required for pathogenicity of Candida albicans
por: Li, Shuixiu, et al.
Publicado: (2021)

Isolation of intact and active FoF1 ATP synthase using a FLAG-tagged subunit from the cyanobacterium Synechocystis sp. PCC 6803
por: Song, Kuo, et al.
Publicado: (2022)

Impact of F1Fo-ATP-synthase dimer assembly factors on mitochondrial function and organismic aging
por: Rampello, Nadia G, et al.
Publicado: (2018)

Caspase inhibition rescues F1Fo ATP synthase dysfunction-mediated dendritic spine elimination
por: Chen, Hao, et al.
Publicado: (2020)

Entrapment of water by subunit c of ATP synthase
por: McGeoch, Julie E.M, et al.
Publicado: (2007)

PKCα and PKCδ: Friends and Rivals
por: Black, Jennifer D., et al.
Publicado: (2022)

The C Ring of the F1Fo ATP Synthase Forms the Mitochondrial Permeability Transition Pore: A Critical Appraisal
por: Halestrap, Andrew P.
Publicado: (2014)

The essential oils component p-cymene induces proton leak through Fo-ATP synthase and uncoupling of mitochondrial respiration
por: Custódio, José BA, et al.
Publicado: (2011)

Regulation of ATP hydrolysis by the ε subunit, ζ subunit and Mg-ADP in the ATP synthase of Paracoccus denitrificans
por: Jarman, Owen D., et al.
Publicado: (2021)

Selective ATP hydrolysis inhibition in F1Fo ATP synthase enhances radiosensitivity in non-small-cell lung cancer cells (A549)
por: Wang, Yupei, et al.
Publicado: (2017)

Identification of cryptic subunits from an apicomplexan ATP synthase
por: Huet, Diego, et al.
Publicado: (2018)

Three Distinct Isoforms of ATP Synthase Subunit c Are Expressed in T. brucei and Assembled into the Mitochondrial ATP Synthase Complex
por: Gulde, Paul E., et al.
Publicado: (2013)

Defective dimerization of FoF1‐ATP synthase secondary to glycation favors mitochondrial energy deficiency in cardiomyocytes during aging
por: Bou‐Teen, Diana, et al.
Publicado: (2022)

NMR chemical shift pattern changed by ammonium sulfate precipitation in cyanobacterial phytochrome Cph1
por: Song, Chen, et al.
Publicado: (2015)

Bedaquiline Targets the ε Subunit of Mycobacterial F-ATP Synthase
por: Kundu, Subhashri, et al.
Publicado: (2016)

Rotor subunits adaptations in ATP synthases from photosynthetic organisms
por: Cheuk, Anthony, et al.
Publicado: (2021)

What Makes You Can also Break You, Part III: Mitochondrial Permeability Transition Pore Formation by an Uncoupling Channel within the C-Subunit Ring of the F1FO ATP Synthase?
por: Chinopoulos, Christos, et al.
Publicado: (2014)

Assembly-dependent translation of subunits 6 (Atp6) and 9 (Atp9) of ATP synthase in yeast mitochondria
por: Kabala, Anna M, et al.
Publicado: (2022)

Enhanced abundance and activity of the chloroplast ATP synthase in rice through the overexpression of the AtpD subunit
por: Ermakova, Maria, et al.
Publicado: (2022)

Deciphering the enigma of RNA editing in the ATP1_alpha subunit of ATP synthase in Triticum aestivum
por: Ibrahim, Mona I.M., et al.
Publicado: (2023)

Differential Roles of the PKC Novel Isoforms, PKCδ and PKCε, in Mouse and Human Platelets
por: Pears, Catherine J., et al.
Publicado: (2008)

ATP synthase subunit alpha and LV mass in ischaemic human hearts
por: Roselló-Lletí, Esther, et al.
Publicado: (2015)

ATP synthase subunit-β down-regulation aggravates diabetic nephropathy
por: Guan, Siao-Syun, et al.
Publicado: (2015)

Genetic inhibition of an ATP synthase subunit extends lifespan in C. elegans
por: Xu, Chen, et al.
Publicado: (2018)

Ordered‐domain unfolding of thermophilic isolated β subunit ATP synthase
por: López‐Pérez, Edgar, et al.
Publicado: (2023)

PKCδ Blues for the β-Cell
por: Schmitz-Peiffer, Carsten, et al.
Publicado: (2010)

Cardioprotective Effect of Danshensu against Ischemic/Reperfusion Injury via c-Subunit of ATP Synthase Inhibition
por: Gao, Qing, et al.
Publicado: (2017)

Overexpressed PKCδ Downregulates the Expression of PKCα in B16F10 Melanoma: Induction of Apoptosis by PKCδ via Ceramide Generation
por: Halder, Kuntal, et al.
Publicado: (2014)

Sequence analysis of the ATP synthase of subunits (ATP8 and ATP6) genes of mitochondrial DNA genome from Ailuropoda melanoleuca
por: Hu, Yaodong, et al.
Publicado: (2018)

Phylogenetic Profiling of Mitochondrial Proteins and Integration Analysis of Bacterial Transcription Units Suggest Evolution of F1Fo ATP Synthase from Multiple Modules
por: Niu, Yulong, et al.
Publicado: (2017)

The Mitochondrial Calcium Uniporter Interacts with Subunit c of the ATP Synthase of Trypanosomes and Humans
por: Huang, Guozhong, et al.
Publicado: (2020)

The ATP Synthase γ Subunit ATPC1 Regulates RNA Editing in Chloroplasts
por: Ni, Jia, et al.
Publicado: (2023)

Deleting the IF(1)-like ζ subunit from Paracoccus denitrificans ATP synthase is not sufficient to activate ATP hydrolysis
por: Varghese, Febin, et al.
Publicado: (2018)

The structural basis of a high affinity ATP binding ε subunit from a bacterial ATP synthase
por: Krah, Alexander, et al.
Publicado: (2017)

A Selective Inhibitor of Cardiac Troponin I Phosphorylation by Delta Protein Kinase C (δPKC) as a Treatment for Ischemia-Reperfusion Injury
por: Qvit, Nir, et al.
Publicado: (2022)

Targeting Mycobacterial F-ATP Synthase C-Terminal α Subunit Interaction Motif on Rotary Subunit γ
por: Harikishore, Amaravadhi, et al.
Publicado: (2021)

XSL-FO
por: Pawson, Dave
Publicado: (2002)

Reduced Levels of ATP Synthase Subunit ATP5F1A Correlate with Earlier-Onset Prostate Cancer
por: Feichtinger, René G., et al.
Publicado: (2018)

Identification of potent inhibitors of ATP synthase subunit c (AtpE) from Mycobacterium tuberculosis using in silico approach
por: Isa, Mustafa Alhaji, et al.
Publicado: (2021)

Cannot write session to /tmp/vufind_sessions/sess_pn7j1eua40h6sf2e8mqsjc6v9g