Cargando…
Metabolic Features of Protochlamydia amoebophila Elementary Bodies – A Link between Activity and Infectivity in Chlamydiae
The Chlamydiae are a highly successful group of obligate intracellular bacteria, whose members are remarkably diverse, ranging from major pathogens of humans and animals to symbionts of ubiquitous protozoa. While their infective developmental stage, the elementary body (EB), has long been accepted t...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3738481/ https://www.ncbi.nlm.nih.gov/pubmed/23950718 http://dx.doi.org/10.1371/journal.ppat.1003553 |
_version_ | 1782476844292898816 |
---|---|
author | Sixt, Barbara S. Siegl, Alexander Müller, Constanze Watzka, Margarete Wultsch, Anna Tziotis, Dimitrios Montanaro, Jacqueline Richter, Andreas Schmitt-Kopplin, Philippe Horn, Matthias |
author_facet | Sixt, Barbara S. Siegl, Alexander Müller, Constanze Watzka, Margarete Wultsch, Anna Tziotis, Dimitrios Montanaro, Jacqueline Richter, Andreas Schmitt-Kopplin, Philippe Horn, Matthias |
author_sort | Sixt, Barbara S. |
collection | PubMed |
description | The Chlamydiae are a highly successful group of obligate intracellular bacteria, whose members are remarkably diverse, ranging from major pathogens of humans and animals to symbionts of ubiquitous protozoa. While their infective developmental stage, the elementary body (EB), has long been accepted to be completely metabolically inert, it has recently been shown to sustain some activities, including uptake of amino acids and protein biosynthesis. In the current study, we performed an in-depth characterization of the metabolic capabilities of EBs of the amoeba symbiont Protochlamydia amoebophila. A combined metabolomics approach, including fluorescence microscopy-based assays, isotope-ratio mass spectrometry (IRMS), ion cyclotron resonance Fourier transform mass spectrometry (ICR/FT-MS), and ultra-performance liquid chromatography mass spectrometry (UPLC-MS) was conducted, with a particular focus on the central carbon metabolism. In addition, the effect of nutrient deprivation on chlamydial infectivity was analyzed. Our investigations revealed that host-free P. amoebophila EBs maintain respiratory activity and metabolize D-glucose, including substrate uptake as well as host-free synthesis of labeled metabolites and release of labeled CO(2) from (13)C-labeled D-glucose. The pentose phosphate pathway was identified as major route of D-glucose catabolism and host-independent activity of the tricarboxylic acid (TCA) cycle was observed. Our data strongly suggest anabolic reactions in P. amoebophila EBs and demonstrate that under the applied conditions D-glucose availability is essential to sustain metabolic activity. Replacement of this substrate by L-glucose, a non-metabolizable sugar, led to a rapid decline in the number of infectious particles. Likewise, infectivity of Chlamydia trachomatis, a major human pathogen, also declined more rapidly in the absence of nutrients. Collectively, these findings demonstrate that D-glucose is utilized by P. amoebophila EBs and provide evidence that metabolic activity in the extracellular stage of chlamydiae is of major biological relevance as it is a critical factor affecting maintenance of infectivity. |
format | Online Article Text |
id | pubmed-3738481 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-37384812013-08-15 Metabolic Features of Protochlamydia amoebophila Elementary Bodies – A Link between Activity and Infectivity in Chlamydiae Sixt, Barbara S. Siegl, Alexander Müller, Constanze Watzka, Margarete Wultsch, Anna Tziotis, Dimitrios Montanaro, Jacqueline Richter, Andreas Schmitt-Kopplin, Philippe Horn, Matthias PLoS Pathog Research Article The Chlamydiae are a highly successful group of obligate intracellular bacteria, whose members are remarkably diverse, ranging from major pathogens of humans and animals to symbionts of ubiquitous protozoa. While their infective developmental stage, the elementary body (EB), has long been accepted to be completely metabolically inert, it has recently been shown to sustain some activities, including uptake of amino acids and protein biosynthesis. In the current study, we performed an in-depth characterization of the metabolic capabilities of EBs of the amoeba symbiont Protochlamydia amoebophila. A combined metabolomics approach, including fluorescence microscopy-based assays, isotope-ratio mass spectrometry (IRMS), ion cyclotron resonance Fourier transform mass spectrometry (ICR/FT-MS), and ultra-performance liquid chromatography mass spectrometry (UPLC-MS) was conducted, with a particular focus on the central carbon metabolism. In addition, the effect of nutrient deprivation on chlamydial infectivity was analyzed. Our investigations revealed that host-free P. amoebophila EBs maintain respiratory activity and metabolize D-glucose, including substrate uptake as well as host-free synthesis of labeled metabolites and release of labeled CO(2) from (13)C-labeled D-glucose. The pentose phosphate pathway was identified as major route of D-glucose catabolism and host-independent activity of the tricarboxylic acid (TCA) cycle was observed. Our data strongly suggest anabolic reactions in P. amoebophila EBs and demonstrate that under the applied conditions D-glucose availability is essential to sustain metabolic activity. Replacement of this substrate by L-glucose, a non-metabolizable sugar, led to a rapid decline in the number of infectious particles. Likewise, infectivity of Chlamydia trachomatis, a major human pathogen, also declined more rapidly in the absence of nutrients. Collectively, these findings demonstrate that D-glucose is utilized by P. amoebophila EBs and provide evidence that metabolic activity in the extracellular stage of chlamydiae is of major biological relevance as it is a critical factor affecting maintenance of infectivity. Public Library of Science 2013-08-08 /pmc/articles/PMC3738481/ /pubmed/23950718 http://dx.doi.org/10.1371/journal.ppat.1003553 Text en © 2013 Sixt et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Sixt, Barbara S. Siegl, Alexander Müller, Constanze Watzka, Margarete Wultsch, Anna Tziotis, Dimitrios Montanaro, Jacqueline Richter, Andreas Schmitt-Kopplin, Philippe Horn, Matthias Metabolic Features of Protochlamydia amoebophila Elementary Bodies – A Link between Activity and Infectivity in Chlamydiae |
title | Metabolic Features of Protochlamydia amoebophila Elementary Bodies – A Link between Activity and Infectivity in Chlamydiae
|
title_full | Metabolic Features of Protochlamydia amoebophila Elementary Bodies – A Link between Activity and Infectivity in Chlamydiae
|
title_fullStr | Metabolic Features of Protochlamydia amoebophila Elementary Bodies – A Link between Activity and Infectivity in Chlamydiae
|
title_full_unstemmed | Metabolic Features of Protochlamydia amoebophila Elementary Bodies – A Link between Activity and Infectivity in Chlamydiae
|
title_short | Metabolic Features of Protochlamydia amoebophila Elementary Bodies – A Link between Activity and Infectivity in Chlamydiae
|
title_sort | metabolic features of protochlamydia amoebophila elementary bodies – a link between activity and infectivity in chlamydiae |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3738481/ https://www.ncbi.nlm.nih.gov/pubmed/23950718 http://dx.doi.org/10.1371/journal.ppat.1003553 |
work_keys_str_mv | AT sixtbarbaras metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT sieglalexander metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT mullerconstanze metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT watzkamargarete metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT wultschanna metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT tziotisdimitrios metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT montanarojacqueline metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT richterandreas metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT schmittkopplinphilippe metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae AT hornmatthias metabolicfeaturesofprotochlamydiaamoebophilaelementarybodiesalinkbetweenactivityandinfectivityinchlamydiae |