Cargando…

Safety and immunogenicity of the quadrivalent HPV vaccine in female Systemic Lupus Erythematosus patients aged 12 to 26 years

BACKGROUND: Women with SLE have higher rates of persistent human papilloma virus (HPV) infections and precancerous lesions than healthy women. HPV vaccine is safe and effective in healthy females aged 9–26 years. There are limited data on the safety and immunogenicity of HPV vaccine in females with...

Descripción completa

Detalles Bibliográficos
Autores principales: Soybilgic, Arzu, Onel, Karen B, Utset, Tammy, Alexander, Kenneth, Wagner-Weiner, Linda
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3751269/
https://www.ncbi.nlm.nih.gov/pubmed/23924237
http://dx.doi.org/10.1186/1546-0096-11-29
_version_ 1782281564810379264
author Soybilgic, Arzu
Onel, Karen B
Utset, Tammy
Alexander, Kenneth
Wagner-Weiner, Linda
author_facet Soybilgic, Arzu
Onel, Karen B
Utset, Tammy
Alexander, Kenneth
Wagner-Weiner, Linda
author_sort Soybilgic, Arzu
collection PubMed
description BACKGROUND: Women with SLE have higher rates of persistent human papilloma virus (HPV) infections and precancerous lesions than healthy women. HPV vaccine is safe and effective in healthy females aged 9–26 years. There are limited data on the safety and immunogenicity of HPV vaccine in females with SLE, and none in adolescents with SLE. Our study evaluates the safety and immunogenicity of recombinant quadrivalent HPV vaccine, Gardasil, in adolescents and young women with SLE. METHODS: This is a prospective, open-label study. Exclusion criteria included disease exacerbation within past 30 days; rituximab or cyclophosphamide within 6 months; pregnancy. Vaccine was administered at months 0, 2, and 6. Physical examination, SLEDAI scores and laboratory studies were performed at months 0, 2, 4, 6 and 7. Each patient’s SLEDAI scores and laboratory profile in the year prior to vaccine administration were used as controls for that patient. Primary outcome measures were change in SLEDAI and mean HPV antibody titers. RESULTS: 27 patients, 12 to 26 years, were enrolled; 20 completed the study. Nine had mild/moderate lupus flares. Mean SLEDAI scores decreased from 6.14 pre-vaccination to 4.49 post-vaccination (p = 0.01). Of 12 patients with lupus nephritis, two experienced worsening renal function during/after the study and progressed to renal failure within 18 months of the study. Both had Class IV lupus nephritis with high chronicity scores (≥ 8) on renal biopsies performed within one year prior to study entry. Seropositivity post-vaccine was >94% for HPV 6, 11, 16 and 18. CONCLUSIONS: Quadrivalent HPV vaccine seems generally safe and well tolerated in this series of adolescents and young women with SLE, with no increase in mean SLEDAI scores. Progression to renal failure in two patients was most likely secondary to pre-existing severe renal chronicity and not secondary to HPV vaccination. Immunogenicity to the quadrivalent HPV vaccine was excellent, with the seropositivity rate >94% in all four HPV types.
format Online
Article
Text
id pubmed-3751269
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-37512692013-08-24 Safety and immunogenicity of the quadrivalent HPV vaccine in female Systemic Lupus Erythematosus patients aged 12 to 26 years Soybilgic, Arzu Onel, Karen B Utset, Tammy Alexander, Kenneth Wagner-Weiner, Linda Pediatr Rheumatol Online J Research BACKGROUND: Women with SLE have higher rates of persistent human papilloma virus (HPV) infections and precancerous lesions than healthy women. HPV vaccine is safe and effective in healthy females aged 9–26 years. There are limited data on the safety and immunogenicity of HPV vaccine in females with SLE, and none in adolescents with SLE. Our study evaluates the safety and immunogenicity of recombinant quadrivalent HPV vaccine, Gardasil, in adolescents and young women with SLE. METHODS: This is a prospective, open-label study. Exclusion criteria included disease exacerbation within past 30 days; rituximab or cyclophosphamide within 6 months; pregnancy. Vaccine was administered at months 0, 2, and 6. Physical examination, SLEDAI scores and laboratory studies were performed at months 0, 2, 4, 6 and 7. Each patient’s SLEDAI scores and laboratory profile in the year prior to vaccine administration were used as controls for that patient. Primary outcome measures were change in SLEDAI and mean HPV antibody titers. RESULTS: 27 patients, 12 to 26 years, were enrolled; 20 completed the study. Nine had mild/moderate lupus flares. Mean SLEDAI scores decreased from 6.14 pre-vaccination to 4.49 post-vaccination (p = 0.01). Of 12 patients with lupus nephritis, two experienced worsening renal function during/after the study and progressed to renal failure within 18 months of the study. Both had Class IV lupus nephritis with high chronicity scores (≥ 8) on renal biopsies performed within one year prior to study entry. Seropositivity post-vaccine was >94% for HPV 6, 11, 16 and 18. CONCLUSIONS: Quadrivalent HPV vaccine seems generally safe and well tolerated in this series of adolescents and young women with SLE, with no increase in mean SLEDAI scores. Progression to renal failure in two patients was most likely secondary to pre-existing severe renal chronicity and not secondary to HPV vaccination. Immunogenicity to the quadrivalent HPV vaccine was excellent, with the seropositivity rate >94% in all four HPV types. BioMed Central 2013-08-07 /pmc/articles/PMC3751269/ /pubmed/23924237 http://dx.doi.org/10.1186/1546-0096-11-29 Text en Copyright © 2013 Soybilgic et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Research
Soybilgic, Arzu
Onel, Karen B
Utset, Tammy
Alexander, Kenneth
Wagner-Weiner, Linda
Safety and immunogenicity of the quadrivalent HPV vaccine in female Systemic Lupus Erythematosus patients aged 12 to 26 years
title Safety and immunogenicity of the quadrivalent HPV vaccine in female Systemic Lupus Erythematosus patients aged 12 to 26 years
title_full Safety and immunogenicity of the quadrivalent HPV vaccine in female Systemic Lupus Erythematosus patients aged 12 to 26 years
title_fullStr Safety and immunogenicity of the quadrivalent HPV vaccine in female Systemic Lupus Erythematosus patients aged 12 to 26 years
title_full_unstemmed Safety and immunogenicity of the quadrivalent HPV vaccine in female Systemic Lupus Erythematosus patients aged 12 to 26 years
title_short Safety and immunogenicity of the quadrivalent HPV vaccine in female Systemic Lupus Erythematosus patients aged 12 to 26 years
title_sort safety and immunogenicity of the quadrivalent hpv vaccine in female systemic lupus erythematosus patients aged 12 to 26 years
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3751269/
https://www.ncbi.nlm.nih.gov/pubmed/23924237
http://dx.doi.org/10.1186/1546-0096-11-29
work_keys_str_mv AT soybilgicarzu safetyandimmunogenicityofthequadrivalenthpvvaccineinfemalesystemiclupuserythematosuspatientsaged12to26years
AT onelkarenb safetyandimmunogenicityofthequadrivalenthpvvaccineinfemalesystemiclupuserythematosuspatientsaged12to26years
AT utsettammy safetyandimmunogenicityofthequadrivalenthpvvaccineinfemalesystemiclupuserythematosuspatientsaged12to26years
AT alexanderkenneth safetyandimmunogenicityofthequadrivalenthpvvaccineinfemalesystemiclupuserythematosuspatientsaged12to26years
AT wagnerweinerlinda safetyandimmunogenicityofthequadrivalenthpvvaccineinfemalesystemiclupuserythematosuspatientsaged12to26years