Cargando…

Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC

Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity...

Descripción completa

Detalles Bibliográficos
Autores principales: Hoerter, John A.H., Brzostek, Joanna, Artyomov, Maxim N., Abel, Steven M., Casas, Javier, Rybakin, Vasily, Ampudia, Jeanette, Lotz, Carina, Connolly, Janet M., Chakraborty, Arup K., Gould, Keith G., Gascoigne, Nicholas R.J.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Rockefeller University Press 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3754861/
https://www.ncbi.nlm.nih.gov/pubmed/23940257
http://dx.doi.org/10.1084/jem.20122528
_version_ 1782281921116504064
author Hoerter, John A.H.
Brzostek, Joanna
Artyomov, Maxim N.
Abel, Steven M.
Casas, Javier
Rybakin, Vasily
Ampudia, Jeanette
Lotz, Carina
Connolly, Janet M.
Chakraborty, Arup K.
Gould, Keith G.
Gascoigne, Nicholas R.J.
author_facet Hoerter, John A.H.
Brzostek, Joanna
Artyomov, Maxim N.
Abel, Steven M.
Casas, Javier
Rybakin, Vasily
Ampudia, Jeanette
Lotz, Carina
Connolly, Janet M.
Chakraborty, Arup K.
Gould, Keith G.
Gascoigne, Nicholas R.J.
author_sort Hoerter, John A.H.
collection PubMed
description Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity for activation enhancers or coagonists. In contrast, the MHCI-restricted cells studied to date show no such peptide specificity for coagonists, suggesting that CD8 binding to noncognate MHCI is more important. Here we show how this dichotomy can be resolved by varying CD8 and TCR binding to agonist and coagonists coupled with computer simulations, and we identify two distinct mechanisms by which CD8 influences the peptide specificity of coagonism. Mechanism 1 identifies the requirement of CD8 binding to noncognate ligand and suggests a direct relationship between the magnitude of coagonism and CD8 affinity for coagonist pMHCI. Mechanism 2 describes how the affinity of CD8 for agonist pMHCI changes the requirement for specific coagonist peptides. MHCs that bind CD8 strongly were tolerant of all or most peptides as coagonists, but weaker CD8-binding MHCs required stronger TCR binding to coagonist, limiting the potential coagonist peptides. These findings in MHCI systems also explain peptide-specific coagonism in MHCII-restricted cells, as CD4–MHCII interaction is generally weaker than CD8–MHCI.
format Online
Article
Text
id pubmed-3754861
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher The Rockefeller University Press
record_format MEDLINE/PubMed
spelling pubmed-37548612014-02-26 Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC Hoerter, John A.H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R.J. J Exp Med Article Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity for activation enhancers or coagonists. In contrast, the MHCI-restricted cells studied to date show no such peptide specificity for coagonists, suggesting that CD8 binding to noncognate MHCI is more important. Here we show how this dichotomy can be resolved by varying CD8 and TCR binding to agonist and coagonists coupled with computer simulations, and we identify two distinct mechanisms by which CD8 influences the peptide specificity of coagonism. Mechanism 1 identifies the requirement of CD8 binding to noncognate ligand and suggests a direct relationship between the magnitude of coagonism and CD8 affinity for coagonist pMHCI. Mechanism 2 describes how the affinity of CD8 for agonist pMHCI changes the requirement for specific coagonist peptides. MHCs that bind CD8 strongly were tolerant of all or most peptides as coagonists, but weaker CD8-binding MHCs required stronger TCR binding to coagonist, limiting the potential coagonist peptides. These findings in MHCI systems also explain peptide-specific coagonism in MHCII-restricted cells, as CD4–MHCII interaction is generally weaker than CD8–MHCI. The Rockefeller University Press 2013-08-26 /pmc/articles/PMC3754861/ /pubmed/23940257 http://dx.doi.org/10.1084/jem.20122528 Text en © 2013 Hoerter et al. This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 3.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/3.0/).
spellingShingle Article
Hoerter, John A.H.
Brzostek, Joanna
Artyomov, Maxim N.
Abel, Steven M.
Casas, Javier
Rybakin, Vasily
Ampudia, Jeanette
Lotz, Carina
Connolly, Janet M.
Chakraborty, Arup K.
Gould, Keith G.
Gascoigne, Nicholas R.J.
Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC
title Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC
title_full Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC
title_fullStr Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC
title_full_unstemmed Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC
title_short Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC
title_sort coreceptor affinity for mhc defines peptide specificity requirements for tcr interaction with coagonist peptide–mhc
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3754861/
https://www.ncbi.nlm.nih.gov/pubmed/23940257
http://dx.doi.org/10.1084/jem.20122528
work_keys_str_mv AT hoerterjohnah coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT brzostekjoanna coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT artyomovmaximn coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT abelstevenm coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT casasjavier coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT rybakinvasily coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT ampudiajeanette coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT lotzcarina coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT connollyjanetm coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT chakrabortyarupk coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT gouldkeithg coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc
AT gascoignenicholasrj coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc