Cargando…
Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC
Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity...
Autores principales: | , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Rockefeller University Press
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3754861/ https://www.ncbi.nlm.nih.gov/pubmed/23940257 http://dx.doi.org/10.1084/jem.20122528 |
_version_ | 1782281921116504064 |
---|---|
author | Hoerter, John A.H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R.J. |
author_facet | Hoerter, John A.H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R.J. |
author_sort | Hoerter, John A.H. |
collection | PubMed |
description | Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity for activation enhancers or coagonists. In contrast, the MHCI-restricted cells studied to date show no such peptide specificity for coagonists, suggesting that CD8 binding to noncognate MHCI is more important. Here we show how this dichotomy can be resolved by varying CD8 and TCR binding to agonist and coagonists coupled with computer simulations, and we identify two distinct mechanisms by which CD8 influences the peptide specificity of coagonism. Mechanism 1 identifies the requirement of CD8 binding to noncognate ligand and suggests a direct relationship between the magnitude of coagonism and CD8 affinity for coagonist pMHCI. Mechanism 2 describes how the affinity of CD8 for agonist pMHCI changes the requirement for specific coagonist peptides. MHCs that bind CD8 strongly were tolerant of all or most peptides as coagonists, but weaker CD8-binding MHCs required stronger TCR binding to coagonist, limiting the potential coagonist peptides. These findings in MHCI systems also explain peptide-specific coagonism in MHCII-restricted cells, as CD4–MHCII interaction is generally weaker than CD8–MHCI. |
format | Online Article Text |
id | pubmed-3754861 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | The Rockefeller University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-37548612014-02-26 Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC Hoerter, John A.H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R.J. J Exp Med Article Recent work has demonstrated that nonstimulatory endogenous peptides can enhance T cell recognition of antigen, but MHCI- and MHCII-restricted systems have generated very different results. MHCII-restricted TCRs need to interact with the nonstimulatory peptide–MHC (pMHC), showing peptide specificity for activation enhancers or coagonists. In contrast, the MHCI-restricted cells studied to date show no such peptide specificity for coagonists, suggesting that CD8 binding to noncognate MHCI is more important. Here we show how this dichotomy can be resolved by varying CD8 and TCR binding to agonist and coagonists coupled with computer simulations, and we identify two distinct mechanisms by which CD8 influences the peptide specificity of coagonism. Mechanism 1 identifies the requirement of CD8 binding to noncognate ligand and suggests a direct relationship between the magnitude of coagonism and CD8 affinity for coagonist pMHCI. Mechanism 2 describes how the affinity of CD8 for agonist pMHCI changes the requirement for specific coagonist peptides. MHCs that bind CD8 strongly were tolerant of all or most peptides as coagonists, but weaker CD8-binding MHCs required stronger TCR binding to coagonist, limiting the potential coagonist peptides. These findings in MHCI systems also explain peptide-specific coagonism in MHCII-restricted cells, as CD4–MHCII interaction is generally weaker than CD8–MHCI. The Rockefeller University Press 2013-08-26 /pmc/articles/PMC3754861/ /pubmed/23940257 http://dx.doi.org/10.1084/jem.20122528 Text en © 2013 Hoerter et al. This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 3.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/3.0/). |
spellingShingle | Article Hoerter, John A.H. Brzostek, Joanna Artyomov, Maxim N. Abel, Steven M. Casas, Javier Rybakin, Vasily Ampudia, Jeanette Lotz, Carina Connolly, Janet M. Chakraborty, Arup K. Gould, Keith G. Gascoigne, Nicholas R.J. Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC |
title | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC |
title_full | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC |
title_fullStr | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC |
title_full_unstemmed | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC |
title_short | Coreceptor affinity for MHC defines peptide specificity requirements for TCR interaction with coagonist peptide–MHC |
title_sort | coreceptor affinity for mhc defines peptide specificity requirements for tcr interaction with coagonist peptide–mhc |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3754861/ https://www.ncbi.nlm.nih.gov/pubmed/23940257 http://dx.doi.org/10.1084/jem.20122528 |
work_keys_str_mv | AT hoerterjohnah coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT brzostekjoanna coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT artyomovmaximn coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT abelstevenm coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT casasjavier coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT rybakinvasily coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT ampudiajeanette coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT lotzcarina coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT connollyjanetm coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT chakrabortyarupk coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT gouldkeithg coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc AT gascoignenicholasrj coreceptoraffinityformhcdefinespeptidespecificityrequirementsfortcrinteractionwithcoagonistpeptidemhc |