Cargando…
A novel role of the natriuretic peptide/cGMP/cGKI pathway in melanoma cells
| Autores principales: | , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2013
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3765523/ http://dx.doi.org/10.1186/2050-6511-14-S1-P19 |
| _version_ | 1782283329479901184 |
|---|---|
| author | Dhayade, Sandeep Feil, Susanne Griessinger, Christoph Kneilling, Manfred Schittek, Birgit Feil, Robert |
| author_facet | Dhayade, Sandeep Feil, Susanne Griessinger, Christoph Kneilling, Manfred Schittek, Birgit Feil, Robert |
| author_sort | Dhayade, Sandeep |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-3765523 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2013 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-37655232013-09-11 A novel role of the natriuretic peptide/cGMP/cGKI pathway in melanoma cells Dhayade, Sandeep Feil, Susanne Griessinger, Christoph Kneilling, Manfred Schittek, Birgit Feil, Robert BMC Pharmacol Toxicol Poster Presentation BioMed Central 2013-08-29 /pmc/articles/PMC3765523/ http://dx.doi.org/10.1186/2050-6511-14-S1-P19 Text en Copyright © 2013 Dhayade et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
| spellingShingle | Poster Presentation Dhayade, Sandeep Feil, Susanne Griessinger, Christoph Kneilling, Manfred Schittek, Birgit Feil, Robert A novel role of the natriuretic peptide/cGMP/cGKI pathway in melanoma cells |
| title | A novel role of the natriuretic peptide/cGMP/cGKI pathway in melanoma cells |
| title_full | A novel role of the natriuretic peptide/cGMP/cGKI pathway in melanoma cells |
| title_fullStr | A novel role of the natriuretic peptide/cGMP/cGKI pathway in melanoma cells |
| title_full_unstemmed | A novel role of the natriuretic peptide/cGMP/cGKI pathway in melanoma cells |
| title_short | A novel role of the natriuretic peptide/cGMP/cGKI pathway in melanoma cells |
| title_sort | novel role of the natriuretic peptide/cgmp/cgki pathway in melanoma cells |
| topic | Poster Presentation |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3765523/ http://dx.doi.org/10.1186/2050-6511-14-S1-P19 |
| work_keys_str_mv | AT dhayadesandeep anovelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT feilsusanne anovelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT griessingerchristoph anovelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT kneillingmanfred anovelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT schittekbirgit anovelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT feilrobert anovelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT dhayadesandeep novelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT feilsusanne novelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT griessingerchristoph novelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT kneillingmanfred novelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT schittekbirgit novelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells AT feilrobert novelroleofthenatriureticpeptidecgmpcgkipathwayinmelanomacells |