Cargando…

A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes

Detalles Bibliográficos
Autores principales: Balkow, Aileen, Jagow, Johanna, Kilic, Ana, Pfeifer, Alexander
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3765680/
http://dx.doi.org/10.1186/2050-6511-14-S1-P4
_version_ 1782283366115049472
author Balkow, Aileen
Jagow, Johanna
Kilic, Ana
Pfeifer, Alexander
author_facet Balkow, Aileen
Jagow, Johanna
Kilic, Ana
Pfeifer, Alexander
author_sort Balkow, Aileen
collection PubMed
description
format Online
Article
Text
id pubmed-3765680
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-37656802013-09-11 A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes Balkow, Aileen Jagow, Johanna Kilic, Ana Pfeifer, Alexander BMC Pharmacol Toxicol Poster Presentation BioMed Central 2013-08-29 /pmc/articles/PMC3765680/ http://dx.doi.org/10.1186/2050-6511-14-S1-P4 Text en Copyright © 2013 Balkow et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Poster Presentation
Balkow, Aileen
Jagow, Johanna
Kilic, Ana
Pfeifer, Alexander
A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes
title A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes
title_full A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes
title_fullStr A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes
title_full_unstemmed A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes
title_short A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes
title_sort possible crosstalk between cgmp pathway and activin receptor-like kinase 7 (alk7) in adipocytes
topic Poster Presentation
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3765680/
http://dx.doi.org/10.1186/2050-6511-14-S1-P4
work_keys_str_mv AT balkowaileen apossiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes
AT jagowjohanna apossiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes
AT kilicana apossiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes
AT pfeiferalexander apossiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes
AT balkowaileen possiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes
AT jagowjohanna possiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes
AT kilicana possiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes
AT pfeiferalexander possiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes