Cargando…
A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3765680/ http://dx.doi.org/10.1186/2050-6511-14-S1-P4 |
_version_ | 1782283366115049472 |
---|---|
author | Balkow, Aileen Jagow, Johanna Kilic, Ana Pfeifer, Alexander |
author_facet | Balkow, Aileen Jagow, Johanna Kilic, Ana Pfeifer, Alexander |
author_sort | Balkow, Aileen |
collection | PubMed |
description | |
format | Online Article Text |
id | pubmed-3765680 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-37656802013-09-11 A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes Balkow, Aileen Jagow, Johanna Kilic, Ana Pfeifer, Alexander BMC Pharmacol Toxicol Poster Presentation BioMed Central 2013-08-29 /pmc/articles/PMC3765680/ http://dx.doi.org/10.1186/2050-6511-14-S1-P4 Text en Copyright © 2013 Balkow et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Poster Presentation Balkow, Aileen Jagow, Johanna Kilic, Ana Pfeifer, Alexander A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes |
title | A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes |
title_full | A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes |
title_fullStr | A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes |
title_full_unstemmed | A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes |
title_short | A possible crosstalk between cGMP pathway and Activin receptor-like kinase 7 (Alk7) in adipocytes |
title_sort | possible crosstalk between cgmp pathway and activin receptor-like kinase 7 (alk7) in adipocytes |
topic | Poster Presentation |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3765680/ http://dx.doi.org/10.1186/2050-6511-14-S1-P4 |
work_keys_str_mv | AT balkowaileen apossiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes AT jagowjohanna apossiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes AT kilicana apossiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes AT pfeiferalexander apossiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes AT balkowaileen possiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes AT jagowjohanna possiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes AT kilicana possiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes AT pfeiferalexander possiblecrosstalkbetweencgmppathwayandactivinreceptorlikekinase7alk7inadipocytes |