Cargando…
PCD Recognizes Outstanding Student Research: Patel et al on Emergency Medical Services Capacity for Prehospital Stroke Care in North Carolina
Autor principal: | |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Centers for Disease Control and Prevention
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3767836/ https://www.ncbi.nlm.nih.gov/pubmed/24007678 http://dx.doi.org/10.5888/pcd10.130247 |
_version_ | 1782283715124133888 |
---|---|
author | Posner, Samuel F. |
author_facet | Posner, Samuel F. |
author_sort | Posner, Samuel F. |
collection | PubMed |
description | |
format | Online Article Text |
id | pubmed-3767836 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Centers for Disease Control and Prevention |
record_format | MEDLINE/PubMed |
spelling | pubmed-37678362013-09-10 PCD Recognizes Outstanding Student Research: Patel et al on Emergency Medical Services Capacity for Prehospital Stroke Care in North Carolina Posner, Samuel F. Prev Chronic Dis Commentary Centers for Disease Control and Prevention 2013-09-05 /pmc/articles/PMC3767836/ /pubmed/24007678 http://dx.doi.org/10.5888/pcd10.130247 Text en https://creativecommons.org/licenses/by/4.0/This is a publication of the U.S. Government. This publication is in the public domain and is therefore without copyright. All text from this work may be reprinted freely. Use of these materials should be properly cited. |
spellingShingle | Commentary Posner, Samuel F. PCD Recognizes Outstanding Student Research: Patel et al on Emergency Medical Services Capacity for Prehospital Stroke Care in North Carolina |
title |
PCD Recognizes Outstanding Student Research: Patel et al on Emergency Medical Services Capacity for Prehospital Stroke Care in North Carolina |
title_full |
PCD Recognizes Outstanding Student Research: Patel et al on Emergency Medical Services Capacity for Prehospital Stroke Care in North Carolina |
title_fullStr |
PCD Recognizes Outstanding Student Research: Patel et al on Emergency Medical Services Capacity for Prehospital Stroke Care in North Carolina |
title_full_unstemmed |
PCD Recognizes Outstanding Student Research: Patel et al on Emergency Medical Services Capacity for Prehospital Stroke Care in North Carolina |
title_short |
PCD Recognizes Outstanding Student Research: Patel et al on Emergency Medical Services Capacity for Prehospital Stroke Care in North Carolina |
title_sort | pcd recognizes outstanding student research: patel et al on emergency medical services capacity for prehospital stroke care in north carolina |
topic | Commentary |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3767836/ https://www.ncbi.nlm.nih.gov/pubmed/24007678 http://dx.doi.org/10.5888/pcd10.130247 |
work_keys_str_mv | AT posnersamuelf pcdrecognizesoutstandingstudentresearchpateletalonemergencymedicalservicescapacityforprehospitalstrokecareinnorthcarolina |