Cargando…
Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells
In the HLA class II–associated autoimmune syndrome rheumatoid arthritis (RA), CD4 T cells are critical drivers of pathogenic immunity. We have explored the metabolic activity of RA T cells and its impact on cellular function and fate. Naive CD4 T cells from RA patients failed to metabolize equal amo...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Rockefeller University Press
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3782046/ https://www.ncbi.nlm.nih.gov/pubmed/24043759 http://dx.doi.org/10.1084/jem.20130252 |
_version_ | 1782285509864718336 |
---|---|
author | Yang, Zhen Fujii, Hiroshi Mohan, Shalini V. Goronzy, Jorg J. Weyand, Cornelia M. |
author_facet | Yang, Zhen Fujii, Hiroshi Mohan, Shalini V. Goronzy, Jorg J. Weyand, Cornelia M. |
author_sort | Yang, Zhen |
collection | PubMed |
description | In the HLA class II–associated autoimmune syndrome rheumatoid arthritis (RA), CD4 T cells are critical drivers of pathogenic immunity. We have explored the metabolic activity of RA T cells and its impact on cellular function and fate. Naive CD4 T cells from RA patients failed to metabolize equal amounts of glucose as age-matched control cells, generated less intracellular ATP, and were apoptosis-susceptible. The defect was attributed to insufficient induction of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3), a regulatory and rate-limiting glycolytic enzyme known to cause the Warburg effect. Forced overexpression of PFKFB3 in RA T cells restored glycolytic flux and protected cells from excessive apoptosis. Hypoglycolytic RA T cells diverted glucose toward the pentose phosphate pathway, generated more NADPH, and consumed intracellular reactive oxygen species (ROS). PFKFB3 deficiency also constrained the ability of RA T cells to resort to autophagy as an alternative means to provide energy and biosynthetic precursor molecules. PFKFB3 silencing and overexpression identified a novel extraglycolytic role of the enzyme in autophagy regulation. In essence, T cells in RA patients, even those in a naive state, are metabolically reprogrammed with insufficient up-regulation of the glycolytic activator PFKFB3, rendering them energy-deprived, ROS- and autophagy-deficient, apoptosis-sensitive, and prone to undergo senescence. |
format | Online Article Text |
id | pubmed-3782046 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | The Rockefeller University Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-37820462014-03-23 Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells Yang, Zhen Fujii, Hiroshi Mohan, Shalini V. Goronzy, Jorg J. Weyand, Cornelia M. J Exp Med Article In the HLA class II–associated autoimmune syndrome rheumatoid arthritis (RA), CD4 T cells are critical drivers of pathogenic immunity. We have explored the metabolic activity of RA T cells and its impact on cellular function and fate. Naive CD4 T cells from RA patients failed to metabolize equal amounts of glucose as age-matched control cells, generated less intracellular ATP, and were apoptosis-susceptible. The defect was attributed to insufficient induction of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3), a regulatory and rate-limiting glycolytic enzyme known to cause the Warburg effect. Forced overexpression of PFKFB3 in RA T cells restored glycolytic flux and protected cells from excessive apoptosis. Hypoglycolytic RA T cells diverted glucose toward the pentose phosphate pathway, generated more NADPH, and consumed intracellular reactive oxygen species (ROS). PFKFB3 deficiency also constrained the ability of RA T cells to resort to autophagy as an alternative means to provide energy and biosynthetic precursor molecules. PFKFB3 silencing and overexpression identified a novel extraglycolytic role of the enzyme in autophagy regulation. In essence, T cells in RA patients, even those in a naive state, are metabolically reprogrammed with insufficient up-regulation of the glycolytic activator PFKFB3, rendering them energy-deprived, ROS- and autophagy-deficient, apoptosis-sensitive, and prone to undergo senescence. The Rockefeller University Press 2013-09-23 /pmc/articles/PMC3782046/ /pubmed/24043759 http://dx.doi.org/10.1084/jem.20130252 Text en © 2013 Yang et al. This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 3.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/3.0/). |
spellingShingle | Article Yang, Zhen Fujii, Hiroshi Mohan, Shalini V. Goronzy, Jorg J. Weyand, Cornelia M. Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells |
title | Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells |
title_full | Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells |
title_fullStr | Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells |
title_full_unstemmed | Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells |
title_short | Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells |
title_sort | phosphofructokinase deficiency impairs atp generation, autophagy, and redox balance in rheumatoid arthritis t cells |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3782046/ https://www.ncbi.nlm.nih.gov/pubmed/24043759 http://dx.doi.org/10.1084/jem.20130252 |
work_keys_str_mv | AT yangzhen phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells AT fujiihiroshi phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells AT mohanshaliniv phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells AT goronzyjorgj phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells AT weyandcorneliam phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells |