Cargando…

Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells

In the HLA class II–associated autoimmune syndrome rheumatoid arthritis (RA), CD4 T cells are critical drivers of pathogenic immunity. We have explored the metabolic activity of RA T cells and its impact on cellular function and fate. Naive CD4 T cells from RA patients failed to metabolize equal amo...

Descripción completa

Detalles Bibliográficos
Autores principales: Yang, Zhen, Fujii, Hiroshi, Mohan, Shalini V., Goronzy, Jorg J., Weyand, Cornelia M.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Rockefeller University Press 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3782046/
https://www.ncbi.nlm.nih.gov/pubmed/24043759
http://dx.doi.org/10.1084/jem.20130252
_version_ 1782285509864718336
author Yang, Zhen
Fujii, Hiroshi
Mohan, Shalini V.
Goronzy, Jorg J.
Weyand, Cornelia M.
author_facet Yang, Zhen
Fujii, Hiroshi
Mohan, Shalini V.
Goronzy, Jorg J.
Weyand, Cornelia M.
author_sort Yang, Zhen
collection PubMed
description In the HLA class II–associated autoimmune syndrome rheumatoid arthritis (RA), CD4 T cells are critical drivers of pathogenic immunity. We have explored the metabolic activity of RA T cells and its impact on cellular function and fate. Naive CD4 T cells from RA patients failed to metabolize equal amounts of glucose as age-matched control cells, generated less intracellular ATP, and were apoptosis-susceptible. The defect was attributed to insufficient induction of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3), a regulatory and rate-limiting glycolytic enzyme known to cause the Warburg effect. Forced overexpression of PFKFB3 in RA T cells restored glycolytic flux and protected cells from excessive apoptosis. Hypoglycolytic RA T cells diverted glucose toward the pentose phosphate pathway, generated more NADPH, and consumed intracellular reactive oxygen species (ROS). PFKFB3 deficiency also constrained the ability of RA T cells to resort to autophagy as an alternative means to provide energy and biosynthetic precursor molecules. PFKFB3 silencing and overexpression identified a novel extraglycolytic role of the enzyme in autophagy regulation. In essence, T cells in RA patients, even those in a naive state, are metabolically reprogrammed with insufficient up-regulation of the glycolytic activator PFKFB3, rendering them energy-deprived, ROS- and autophagy-deficient, apoptosis-sensitive, and prone to undergo senescence.
format Online
Article
Text
id pubmed-3782046
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher The Rockefeller University Press
record_format MEDLINE/PubMed
spelling pubmed-37820462014-03-23 Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells Yang, Zhen Fujii, Hiroshi Mohan, Shalini V. Goronzy, Jorg J. Weyand, Cornelia M. J Exp Med Article In the HLA class II–associated autoimmune syndrome rheumatoid arthritis (RA), CD4 T cells are critical drivers of pathogenic immunity. We have explored the metabolic activity of RA T cells and its impact on cellular function and fate. Naive CD4 T cells from RA patients failed to metabolize equal amounts of glucose as age-matched control cells, generated less intracellular ATP, and were apoptosis-susceptible. The defect was attributed to insufficient induction of 6-phosphofructo-2-kinase/fructose-2,6-bisphosphatase 3 (PFKFB3), a regulatory and rate-limiting glycolytic enzyme known to cause the Warburg effect. Forced overexpression of PFKFB3 in RA T cells restored glycolytic flux and protected cells from excessive apoptosis. Hypoglycolytic RA T cells diverted glucose toward the pentose phosphate pathway, generated more NADPH, and consumed intracellular reactive oxygen species (ROS). PFKFB3 deficiency also constrained the ability of RA T cells to resort to autophagy as an alternative means to provide energy and biosynthetic precursor molecules. PFKFB3 silencing and overexpression identified a novel extraglycolytic role of the enzyme in autophagy regulation. In essence, T cells in RA patients, even those in a naive state, are metabolically reprogrammed with insufficient up-regulation of the glycolytic activator PFKFB3, rendering them energy-deprived, ROS- and autophagy-deficient, apoptosis-sensitive, and prone to undergo senescence. The Rockefeller University Press 2013-09-23 /pmc/articles/PMC3782046/ /pubmed/24043759 http://dx.doi.org/10.1084/jem.20130252 Text en © 2013 Yang et al. This article is distributed under the terms of an Attribution–Noncommercial–Share Alike–No Mirror Sites license for the first six months after the publication date (see http://www.rupress.org/terms). After six months it is available under a Creative Commons License (Attribution–Noncommercial–Share Alike 3.0 Unported license, as described at http://creativecommons.org/licenses/by-nc-sa/3.0/).
spellingShingle Article
Yang, Zhen
Fujii, Hiroshi
Mohan, Shalini V.
Goronzy, Jorg J.
Weyand, Cornelia M.
Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells
title Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells
title_full Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells
title_fullStr Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells
title_full_unstemmed Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells
title_short Phosphofructokinase deficiency impairs ATP generation, autophagy, and redox balance in rheumatoid arthritis T cells
title_sort phosphofructokinase deficiency impairs atp generation, autophagy, and redox balance in rheumatoid arthritis t cells
topic Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3782046/
https://www.ncbi.nlm.nih.gov/pubmed/24043759
http://dx.doi.org/10.1084/jem.20130252
work_keys_str_mv AT yangzhen phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells
AT fujiihiroshi phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells
AT mohanshaliniv phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells
AT goronzyjorgj phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells
AT weyandcorneliam phosphofructokinasedeficiencyimpairsatpgenerationautophagyandredoxbalanceinrheumatoidarthritistcells