Cargando…

Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma

PURPOSE: To investigate the relationship between retinal nerve fiber layer (RNFL) thickness and retinal pigment epithelium alterations in patients with advanced glaucomatous visual field defects. METHODS: A consecutive, prospective series of 82 study eyes with primary open-angle glaucoma and advance...

Descripción completa

Detalles Bibliográficos
Autores principales: Reznicek, Lukas, Seidensticker, Florian, Mann, Thomas, Hübert, Irene, Buerger, Alexandra, Haritoglou, Christos, Neubauer, Aljoscha S, Kampik, Anselm, Hirneiss, Christoph, Kernt, Marcus
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Dove Medical Press 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3788816/
https://www.ncbi.nlm.nih.gov/pubmed/24092967
http://dx.doi.org/10.2147/OPTH.S49112
_version_ 1782286366601641984
author Reznicek, Lukas
Seidensticker, Florian
Mann, Thomas
Hübert, Irene
Buerger, Alexandra
Haritoglou, Christos
Neubauer, Aljoscha S
Kampik, Anselm
Hirneiss, Christoph
Kernt, Marcus
author_facet Reznicek, Lukas
Seidensticker, Florian
Mann, Thomas
Hübert, Irene
Buerger, Alexandra
Haritoglou, Christos
Neubauer, Aljoscha S
Kampik, Anselm
Hirneiss, Christoph
Kernt, Marcus
author_sort Reznicek, Lukas
collection PubMed
description PURPOSE: To investigate the relationship between retinal nerve fiber layer (RNFL) thickness and retinal pigment epithelium alterations in patients with advanced glaucomatous visual field defects. METHODS: A consecutive, prospective series of 82 study eyes with primary open-angle glaucoma and advanced glaucomatous visual field defects were included in this study. All study participants underwent a full ophthalmic examination followed by visual field testing with standard automated perimetry as well as spectral-domain optical coherence tomography (SD-OCT) for peripapillary RNFL thickness and Optos wide-field fundus autofluorescence (FAF) images. A pattern grid with corresponding locations between functional visual field sectors and structural peripapillary RNFL thickness was aligned to the FAF images at corresponding location. Mean FAF intensity (range: 0 = black and 255 = white) of each evaluated sector (superotemporal, temporal, inferotemporal, inferonasal, nasal, superonasal) was correlated with the corresponding peripapillary RNFL thickness obtained with SD-OCT. RESULTS: Correlation analyses between sectoral RNFL thickness and standardized FAF intensity in the corresponding topographic retina segments revealed partly significant correlations with correlation coefficients ranging between 0.004 and 0.376 and were statistically significant in the temporal inferior central field (r = 0.324, P = 0.036) and the nasal field (r = 0.376, P = 0.014). CONCLUSION: Retinal pigment epithelium abnormalities correlate with corresponding peripapillary RNFL damage, especially in the temporal inferior sector of patients with advanced glaucomatous visual field defects. A further evaluation of FAF as a potential predictive parameter for glaucomatous damage is necessary.
format Online
Article
Text
id pubmed-3788816
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Dove Medical Press
record_format MEDLINE/PubMed
spelling pubmed-37888162013-10-03 Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma Reznicek, Lukas Seidensticker, Florian Mann, Thomas Hübert, Irene Buerger, Alexandra Haritoglou, Christos Neubauer, Aljoscha S Kampik, Anselm Hirneiss, Christoph Kernt, Marcus Clin Ophthalmol Original Research PURPOSE: To investigate the relationship between retinal nerve fiber layer (RNFL) thickness and retinal pigment epithelium alterations in patients with advanced glaucomatous visual field defects. METHODS: A consecutive, prospective series of 82 study eyes with primary open-angle glaucoma and advanced glaucomatous visual field defects were included in this study. All study participants underwent a full ophthalmic examination followed by visual field testing with standard automated perimetry as well as spectral-domain optical coherence tomography (SD-OCT) for peripapillary RNFL thickness and Optos wide-field fundus autofluorescence (FAF) images. A pattern grid with corresponding locations between functional visual field sectors and structural peripapillary RNFL thickness was aligned to the FAF images at corresponding location. Mean FAF intensity (range: 0 = black and 255 = white) of each evaluated sector (superotemporal, temporal, inferotemporal, inferonasal, nasal, superonasal) was correlated with the corresponding peripapillary RNFL thickness obtained with SD-OCT. RESULTS: Correlation analyses between sectoral RNFL thickness and standardized FAF intensity in the corresponding topographic retina segments revealed partly significant correlations with correlation coefficients ranging between 0.004 and 0.376 and were statistically significant in the temporal inferior central field (r = 0.324, P = 0.036) and the nasal field (r = 0.376, P = 0.014). CONCLUSION: Retinal pigment epithelium abnormalities correlate with corresponding peripapillary RNFL damage, especially in the temporal inferior sector of patients with advanced glaucomatous visual field defects. A further evaluation of FAF as a potential predictive parameter for glaucomatous damage is necessary. Dove Medical Press 2013 2013-09-19 /pmc/articles/PMC3788816/ /pubmed/24092967 http://dx.doi.org/10.2147/OPTH.S49112 Text en © 2013 Reznicek et al. This work is published by Dove Medical Press Ltd, and licensed under Creative Commons Attribution – Non Commercial (unported, v3.0) License The full terms of the License are available at http://creativecommons.org/licenses/by-nc/3.0/. Non-commercial uses of the work are permitted without any further permission from Dove Medical Press Ltd, provided the work is properly attributed.
spellingShingle Original Research
Reznicek, Lukas
Seidensticker, Florian
Mann, Thomas
Hübert, Irene
Buerger, Alexandra
Haritoglou, Christos
Neubauer, Aljoscha S
Kampik, Anselm
Hirneiss, Christoph
Kernt, Marcus
Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_full Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_fullStr Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_full_unstemmed Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_short Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
title_sort correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
topic Original Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3788816/
https://www.ncbi.nlm.nih.gov/pubmed/24092967
http://dx.doi.org/10.2147/OPTH.S49112
work_keys_str_mv AT rezniceklukas correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT seidenstickerflorian correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT mannthomas correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT hubertirene correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT buergeralexandra correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT haritoglouchristos correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT neubaueraljoschas correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT kampikanselm correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT hirneisschristoph correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma
AT kerntmarcus correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma