Cargando…
Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma
PURPOSE: To investigate the relationship between retinal nerve fiber layer (RNFL) thickness and retinal pigment epithelium alterations in patients with advanced glaucomatous visual field defects. METHODS: A consecutive, prospective series of 82 study eyes with primary open-angle glaucoma and advance...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Dove Medical Press
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3788816/ https://www.ncbi.nlm.nih.gov/pubmed/24092967 http://dx.doi.org/10.2147/OPTH.S49112 |
_version_ | 1782286366601641984 |
---|---|
author | Reznicek, Lukas Seidensticker, Florian Mann, Thomas Hübert, Irene Buerger, Alexandra Haritoglou, Christos Neubauer, Aljoscha S Kampik, Anselm Hirneiss, Christoph Kernt, Marcus |
author_facet | Reznicek, Lukas Seidensticker, Florian Mann, Thomas Hübert, Irene Buerger, Alexandra Haritoglou, Christos Neubauer, Aljoscha S Kampik, Anselm Hirneiss, Christoph Kernt, Marcus |
author_sort | Reznicek, Lukas |
collection | PubMed |
description | PURPOSE: To investigate the relationship between retinal nerve fiber layer (RNFL) thickness and retinal pigment epithelium alterations in patients with advanced glaucomatous visual field defects. METHODS: A consecutive, prospective series of 82 study eyes with primary open-angle glaucoma and advanced glaucomatous visual field defects were included in this study. All study participants underwent a full ophthalmic examination followed by visual field testing with standard automated perimetry as well as spectral-domain optical coherence tomography (SD-OCT) for peripapillary RNFL thickness and Optos wide-field fundus autofluorescence (FAF) images. A pattern grid with corresponding locations between functional visual field sectors and structural peripapillary RNFL thickness was aligned to the FAF images at corresponding location. Mean FAF intensity (range: 0 = black and 255 = white) of each evaluated sector (superotemporal, temporal, inferotemporal, inferonasal, nasal, superonasal) was correlated with the corresponding peripapillary RNFL thickness obtained with SD-OCT. RESULTS: Correlation analyses between sectoral RNFL thickness and standardized FAF intensity in the corresponding topographic retina segments revealed partly significant correlations with correlation coefficients ranging between 0.004 and 0.376 and were statistically significant in the temporal inferior central field (r = 0.324, P = 0.036) and the nasal field (r = 0.376, P = 0.014). CONCLUSION: Retinal pigment epithelium abnormalities correlate with corresponding peripapillary RNFL damage, especially in the temporal inferior sector of patients with advanced glaucomatous visual field defects. A further evaluation of FAF as a potential predictive parameter for glaucomatous damage is necessary. |
format | Online Article Text |
id | pubmed-3788816 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Dove Medical Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-37888162013-10-03 Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma Reznicek, Lukas Seidensticker, Florian Mann, Thomas Hübert, Irene Buerger, Alexandra Haritoglou, Christos Neubauer, Aljoscha S Kampik, Anselm Hirneiss, Christoph Kernt, Marcus Clin Ophthalmol Original Research PURPOSE: To investigate the relationship between retinal nerve fiber layer (RNFL) thickness and retinal pigment epithelium alterations in patients with advanced glaucomatous visual field defects. METHODS: A consecutive, prospective series of 82 study eyes with primary open-angle glaucoma and advanced glaucomatous visual field defects were included in this study. All study participants underwent a full ophthalmic examination followed by visual field testing with standard automated perimetry as well as spectral-domain optical coherence tomography (SD-OCT) for peripapillary RNFL thickness and Optos wide-field fundus autofluorescence (FAF) images. A pattern grid with corresponding locations between functional visual field sectors and structural peripapillary RNFL thickness was aligned to the FAF images at corresponding location. Mean FAF intensity (range: 0 = black and 255 = white) of each evaluated sector (superotemporal, temporal, inferotemporal, inferonasal, nasal, superonasal) was correlated with the corresponding peripapillary RNFL thickness obtained with SD-OCT. RESULTS: Correlation analyses between sectoral RNFL thickness and standardized FAF intensity in the corresponding topographic retina segments revealed partly significant correlations with correlation coefficients ranging between 0.004 and 0.376 and were statistically significant in the temporal inferior central field (r = 0.324, P = 0.036) and the nasal field (r = 0.376, P = 0.014). CONCLUSION: Retinal pigment epithelium abnormalities correlate with corresponding peripapillary RNFL damage, especially in the temporal inferior sector of patients with advanced glaucomatous visual field defects. A further evaluation of FAF as a potential predictive parameter for glaucomatous damage is necessary. Dove Medical Press 2013 2013-09-19 /pmc/articles/PMC3788816/ /pubmed/24092967 http://dx.doi.org/10.2147/OPTH.S49112 Text en © 2013 Reznicek et al. This work is published by Dove Medical Press Ltd, and licensed under Creative Commons Attribution – Non Commercial (unported, v3.0) License The full terms of the License are available at http://creativecommons.org/licenses/by-nc/3.0/. Non-commercial uses of the work are permitted without any further permission from Dove Medical Press Ltd, provided the work is properly attributed. |
spellingShingle | Original Research Reznicek, Lukas Seidensticker, Florian Mann, Thomas Hübert, Irene Buerger, Alexandra Haritoglou, Christos Neubauer, Aljoscha S Kampik, Anselm Hirneiss, Christoph Kernt, Marcus Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma |
title | Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma |
title_full | Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma |
title_fullStr | Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma |
title_full_unstemmed | Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma |
title_short | Correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma |
title_sort | correlation between peripapillary retinal nerve fiber layer thickness and fundus autofluorescence in primary open-angle glaucoma |
topic | Original Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3788816/ https://www.ncbi.nlm.nih.gov/pubmed/24092967 http://dx.doi.org/10.2147/OPTH.S49112 |
work_keys_str_mv | AT rezniceklukas correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT seidenstickerflorian correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT mannthomas correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT hubertirene correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT buergeralexandra correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT haritoglouchristos correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT neubaueraljoschas correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT kampikanselm correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT hirneisschristoph correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma AT kerntmarcus correlationbetweenperipapillaryretinalnervefiberlayerthicknessandfundusautofluorescenceinprimaryopenangleglaucoma |