Cargando…

Endosomal trafficking of the receptor tyrosine kinase MuSK proceeds via clathrin-dependent pathways, Arf6 and actin

Muscle-specific kinase (MuSK), a receptor tyrosine kinase, is the key player during the formation of the neuromuscular junction. Signal transduction events downstream of MuSK activation induce both pre-and postsynaptic differentiation, which, most prominently, includes the clustering of acetylcholin...

Descripción completa

Detalles Bibliográficos
Autores principales: Luiskandl, Susan, Woller, Barbara, Schlauf, Marlies, Schmid, Johannes A, Herbst, Ruth
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Blackwell Publishing Ltd 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3806275/
https://www.ncbi.nlm.nih.gov/pubmed/23621612
http://dx.doi.org/10.1111/febs.12309
_version_ 1782288358371753984
author Luiskandl, Susan
Woller, Barbara
Schlauf, Marlies
Schmid, Johannes A
Herbst, Ruth
author_facet Luiskandl, Susan
Woller, Barbara
Schlauf, Marlies
Schmid, Johannes A
Herbst, Ruth
author_sort Luiskandl, Susan
collection PubMed
description Muscle-specific kinase (MuSK), a receptor tyrosine kinase, is the key player during the formation of the neuromuscular junction. Signal transduction events downstream of MuSK activation induce both pre-and postsynaptic differentiation, which, most prominently, includes the clustering of acetylcholine receptors at synaptic sites. More recently, regulated MuSK endocytosis and degradation have been implicated as crucial events for MuSK signalling activity, implicating a cross-talk between signalling and endocytosis. In the present study, we use a live imaging approach to study MuSK endocytosis. We find that MuSK is internalized via a clathrin-, dynamin-dependent pathway. MuSK is transported to Rab7-positive endosomes for degradation and recycled via Rab4-and Rab11-positive vesicles. MuSK activation by Dok7 mildly affects the localization of MuSK on the cell surface but has no effect on the rate of MuSK internalization. Interestingly, MuSK colocalizes with actin and Arf6 at the cell surface and during endosomal trafficking. Disruption of the actin cytoskeleton or the proper function of Arf6 concentrates MuSK in cell protrusions. Moreover, inhibition of Arf6 or cytoskeletal rearrangements impairs acetylcholine receptor clustering and phosphorylation. These results suggest that MuSK uses both classical and nonclassical endosomal pathways that involve a variety of different components of the endosomal machinery. STRUCTURED DIGITAL ABSTRACT: MuSK and Arf6 colocalize by fluorescence microscopy (View Interaction: 1, 2). MuSK and Rab4 colocalize by fluorescence microscopy (View interaction). MuSK and Rab11 colocalize by fluorescence microscopy (View interaction). MuSK and Rab7 colocalize by fluorescence microscopy (View interaction).
format Online
Article
Text
id pubmed-3806275
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Blackwell Publishing Ltd
record_format MEDLINE/PubMed
spelling pubmed-38062752013-11-03 Endosomal trafficking of the receptor tyrosine kinase MuSK proceeds via clathrin-dependent pathways, Arf6 and actin Luiskandl, Susan Woller, Barbara Schlauf, Marlies Schmid, Johannes A Herbst, Ruth FEBS J Original Articles Muscle-specific kinase (MuSK), a receptor tyrosine kinase, is the key player during the formation of the neuromuscular junction. Signal transduction events downstream of MuSK activation induce both pre-and postsynaptic differentiation, which, most prominently, includes the clustering of acetylcholine receptors at synaptic sites. More recently, regulated MuSK endocytosis and degradation have been implicated as crucial events for MuSK signalling activity, implicating a cross-talk between signalling and endocytosis. In the present study, we use a live imaging approach to study MuSK endocytosis. We find that MuSK is internalized via a clathrin-, dynamin-dependent pathway. MuSK is transported to Rab7-positive endosomes for degradation and recycled via Rab4-and Rab11-positive vesicles. MuSK activation by Dok7 mildly affects the localization of MuSK on the cell surface but has no effect on the rate of MuSK internalization. Interestingly, MuSK colocalizes with actin and Arf6 at the cell surface and during endosomal trafficking. Disruption of the actin cytoskeleton or the proper function of Arf6 concentrates MuSK in cell protrusions. Moreover, inhibition of Arf6 or cytoskeletal rearrangements impairs acetylcholine receptor clustering and phosphorylation. These results suggest that MuSK uses both classical and nonclassical endosomal pathways that involve a variety of different components of the endosomal machinery. STRUCTURED DIGITAL ABSTRACT: MuSK and Arf6 colocalize by fluorescence microscopy (View Interaction: 1, 2). MuSK and Rab4 colocalize by fluorescence microscopy (View interaction). MuSK and Rab11 colocalize by fluorescence microscopy (View interaction). MuSK and Rab7 colocalize by fluorescence microscopy (View interaction). Blackwell Publishing Ltd 2013-07 2013-05-23 /pmc/articles/PMC3806275/ /pubmed/23621612 http://dx.doi.org/10.1111/febs.12309 Text en Copyright © 2013 Federation of European Biochemical Societies http://creativecommons.org/licenses/by/2.5/ Re-use of this article is permitted in accordance with the Creative Commons Deed, Attribution 2.5, which does not permit commercial exploitation.
spellingShingle Original Articles
Luiskandl, Susan
Woller, Barbara
Schlauf, Marlies
Schmid, Johannes A
Herbst, Ruth
Endosomal trafficking of the receptor tyrosine kinase MuSK proceeds via clathrin-dependent pathways, Arf6 and actin
title Endosomal trafficking of the receptor tyrosine kinase MuSK proceeds via clathrin-dependent pathways, Arf6 and actin
title_full Endosomal trafficking of the receptor tyrosine kinase MuSK proceeds via clathrin-dependent pathways, Arf6 and actin
title_fullStr Endosomal trafficking of the receptor tyrosine kinase MuSK proceeds via clathrin-dependent pathways, Arf6 and actin
title_full_unstemmed Endosomal trafficking of the receptor tyrosine kinase MuSK proceeds via clathrin-dependent pathways, Arf6 and actin
title_short Endosomal trafficking of the receptor tyrosine kinase MuSK proceeds via clathrin-dependent pathways, Arf6 and actin
title_sort endosomal trafficking of the receptor tyrosine kinase musk proceeds via clathrin-dependent pathways, arf6 and actin
topic Original Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3806275/
https://www.ncbi.nlm.nih.gov/pubmed/23621612
http://dx.doi.org/10.1111/febs.12309
work_keys_str_mv AT luiskandlsusan endosomaltraffickingofthereceptortyrosinekinasemuskproceedsviaclathrindependentpathwaysarf6andactin
AT wollerbarbara endosomaltraffickingofthereceptortyrosinekinasemuskproceedsviaclathrindependentpathwaysarf6andactin
AT schlaufmarlies endosomaltraffickingofthereceptortyrosinekinasemuskproceedsviaclathrindependentpathwaysarf6andactin
AT schmidjohannesa endosomaltraffickingofthereceptortyrosinekinasemuskproceedsviaclathrindependentpathwaysarf6andactin
AT herbstruth endosomaltraffickingofthereceptortyrosinekinasemuskproceedsviaclathrindependentpathwaysarf6andactin