Cargando…

Involvement of Caenohabditis elegans MAPK Signaling Pathways in Oxidative Stress Response Induced by Silver Nanoparticles Exposure

In the present study, toxicity of silver nanoparticles (AgNPs) was investigated in the nematode, Caenohabditis elegans focusing on the upstream signaling pathway responsible for regulating oxidative stress, such as mitogen-activated protein kinase (MAPK) cascades. Formation of reactive oxygen specie...

Descripción completa

Detalles Bibliográficos
Autores principales: Roh, Ji-Yeon, Eom, Hyun-Jeong, Choi, Jinhee
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Korean Society of Toxicology 2012
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3834395/
https://www.ncbi.nlm.nih.gov/pubmed/24278585
http://dx.doi.org/10.5487/TR.2012.28.1.019
_version_ 1782291979429740544
author Roh, Ji-Yeon
Eom, Hyun-Jeong
Choi, Jinhee
author_facet Roh, Ji-Yeon
Eom, Hyun-Jeong
Choi, Jinhee
author_sort Roh, Ji-Yeon
collection PubMed
description In the present study, toxicity of silver nanoparticles (AgNPs) was investigated in the nematode, Caenohabditis elegans focusing on the upstream signaling pathway responsible for regulating oxidative stress, such as mitogen-activated protein kinase (MAPK) cascades. Formation of reactive oxygen species (ROS) was observed in AgNPs exposed C.elegans, suggesting oxidative stress as an important mechanism in the toxicity of AgNPs towards C. elegans. Expression of genes in MAPK signaling pathways increased by AgNPs exposure in less than 2-fold compared to the control in wildtype C.elegans, however, those were increased dramatically in sod-3 (gk235) mutant after 48 h exposure of AgNPs (i.e. 4-fold for jnk-1 and mpk-2; 6-fold for nsy-1, sek-1, and pmk-1, and 10-fold for jkk-1). These results on the expression of oxidative stress response genes suggest that sod-3 gene expression appears to be dependent on p38 MAPK activation. The high expressions of the pmk-1 gene 48 h exposure to AgNPs in the sod-3 (gk235) mutant can also be interpreted as compensatory mechanisms in the absence of important stress response genes. Overall results suggest that MAPK-based integrated stress signaling network seems to be involved in defense to AgNPs exposure in C.elegans.
format Online
Article
Text
id pubmed-3834395
institution National Center for Biotechnology Information
language English
publishDate 2012
publisher The Korean Society of Toxicology
record_format MEDLINE/PubMed
spelling pubmed-38343952013-11-25 Involvement of Caenohabditis elegans MAPK Signaling Pathways in Oxidative Stress Response Induced by Silver Nanoparticles Exposure Roh, Ji-Yeon Eom, Hyun-Jeong Choi, Jinhee Toxicol Res Articles In the present study, toxicity of silver nanoparticles (AgNPs) was investigated in the nematode, Caenohabditis elegans focusing on the upstream signaling pathway responsible for regulating oxidative stress, such as mitogen-activated protein kinase (MAPK) cascades. Formation of reactive oxygen species (ROS) was observed in AgNPs exposed C.elegans, suggesting oxidative stress as an important mechanism in the toxicity of AgNPs towards C. elegans. Expression of genes in MAPK signaling pathways increased by AgNPs exposure in less than 2-fold compared to the control in wildtype C.elegans, however, those were increased dramatically in sod-3 (gk235) mutant after 48 h exposure of AgNPs (i.e. 4-fold for jnk-1 and mpk-2; 6-fold for nsy-1, sek-1, and pmk-1, and 10-fold for jkk-1). These results on the expression of oxidative stress response genes suggest that sod-3 gene expression appears to be dependent on p38 MAPK activation. The high expressions of the pmk-1 gene 48 h exposure to AgNPs in the sod-3 (gk235) mutant can also be interpreted as compensatory mechanisms in the absence of important stress response genes. Overall results suggest that MAPK-based integrated stress signaling network seems to be involved in defense to AgNPs exposure in C.elegans. The Korean Society of Toxicology 2012-03 /pmc/articles/PMC3834395/ /pubmed/24278585 http://dx.doi.org/10.5487/TR.2012.28.1.019 Text en Copyright ©2012, The Korean Society of Toxicology
spellingShingle Articles
Roh, Ji-Yeon
Eom, Hyun-Jeong
Choi, Jinhee
Involvement of Caenohabditis elegans MAPK Signaling Pathways in Oxidative Stress Response Induced by Silver Nanoparticles Exposure
title Involvement of Caenohabditis elegans MAPK Signaling Pathways in Oxidative Stress Response Induced by Silver Nanoparticles Exposure
title_full Involvement of Caenohabditis elegans MAPK Signaling Pathways in Oxidative Stress Response Induced by Silver Nanoparticles Exposure
title_fullStr Involvement of Caenohabditis elegans MAPK Signaling Pathways in Oxidative Stress Response Induced by Silver Nanoparticles Exposure
title_full_unstemmed Involvement of Caenohabditis elegans MAPK Signaling Pathways in Oxidative Stress Response Induced by Silver Nanoparticles Exposure
title_short Involvement of Caenohabditis elegans MAPK Signaling Pathways in Oxidative Stress Response Induced by Silver Nanoparticles Exposure
title_sort involvement of caenohabditis elegans mapk signaling pathways in oxidative stress response induced by silver nanoparticles exposure
topic Articles
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3834395/
https://www.ncbi.nlm.nih.gov/pubmed/24278585
http://dx.doi.org/10.5487/TR.2012.28.1.019
work_keys_str_mv AT rohjiyeon involvementofcaenohabditiselegansmapksignalingpathwaysinoxidativestressresponseinducedbysilvernanoparticlesexposure
AT eomhyunjeong involvementofcaenohabditiselegansmapksignalingpathwaysinoxidativestressresponseinducedbysilvernanoparticlesexposure
AT choijinhee involvementofcaenohabditiselegansmapksignalingpathwaysinoxidativestressresponseinducedbysilvernanoparticlesexposure