Cargando…
Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review
Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut functio...
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3835942/ https://www.ncbi.nlm.nih.gov/pubmed/24282510 http://dx.doi.org/10.1371/journal.pone.0079603 |
_version_ | 1782292239923281920 |
---|---|
author | Trobec, Katja Kerec Kos, Mojca von Haehling, Stephan Springer, Jochen Anker, Stefan D. Lainscak, Mitja |
author_facet | Trobec, Katja Kerec Kos, Mojca von Haehling, Stephan Springer, Jochen Anker, Stefan D. Lainscak, Mitja |
author_sort | Trobec, Katja |
collection | PubMed |
description | Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut function and decreased subcutaneous tissue may influence the absorption of orally and transdermally applied drugs. Altered body composition and plasma protein concentration may affect drug distribution. Changes in the expression and function of metabolic enzymes could influence the metabolism of drugs, and their renal excretion could be affected by possible reduction in kidney function. Because no general guidelines exist for drug dose adjustments in cachectic patients, we conducted a systematic search to identify articles that investigated the pharmacokinetics of drugs in cachectic patients. |
format | Online Article Text |
id | pubmed-3835942 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-38359422013-11-26 Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review Trobec, Katja Kerec Kos, Mojca von Haehling, Stephan Springer, Jochen Anker, Stefan D. Lainscak, Mitja PLoS One Research Article Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut function and decreased subcutaneous tissue may influence the absorption of orally and transdermally applied drugs. Altered body composition and plasma protein concentration may affect drug distribution. Changes in the expression and function of metabolic enzymes could influence the metabolism of drugs, and their renal excretion could be affected by possible reduction in kidney function. Because no general guidelines exist for drug dose adjustments in cachectic patients, we conducted a systematic search to identify articles that investigated the pharmacokinetics of drugs in cachectic patients. Public Library of Science 2013-11-08 /pmc/articles/PMC3835942/ /pubmed/24282510 http://dx.doi.org/10.1371/journal.pone.0079603 Text en © 2013 Trobec et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Trobec, Katja Kerec Kos, Mojca von Haehling, Stephan Springer, Jochen Anker, Stefan D. Lainscak, Mitja Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review |
title | Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review |
title_full | Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review |
title_fullStr | Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review |
title_full_unstemmed | Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review |
title_short | Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review |
title_sort | pharmacokinetics of drugs in cachectic patients: a systematic review |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3835942/ https://www.ncbi.nlm.nih.gov/pubmed/24282510 http://dx.doi.org/10.1371/journal.pone.0079603 |
work_keys_str_mv | AT trobeckatja pharmacokineticsofdrugsincachecticpatientsasystematicreview AT kereckosmojca pharmacokineticsofdrugsincachecticpatientsasystematicreview AT vonhaehlingstephan pharmacokineticsofdrugsincachecticpatientsasystematicreview AT springerjochen pharmacokineticsofdrugsincachecticpatientsasystematicreview AT ankerstefand pharmacokineticsofdrugsincachecticpatientsasystematicreview AT lainscakmitja pharmacokineticsofdrugsincachecticpatientsasystematicreview |