Cargando…

Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review

Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut functio...

Descripción completa

Detalles Bibliográficos
Autores principales: Trobec, Katja, Kerec Kos, Mojca, von Haehling, Stephan, Springer, Jochen, Anker, Stefan D., Lainscak, Mitja
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3835942/
https://www.ncbi.nlm.nih.gov/pubmed/24282510
http://dx.doi.org/10.1371/journal.pone.0079603
_version_ 1782292239923281920
author Trobec, Katja
Kerec Kos, Mojca
von Haehling, Stephan
Springer, Jochen
Anker, Stefan D.
Lainscak, Mitja
author_facet Trobec, Katja
Kerec Kos, Mojca
von Haehling, Stephan
Springer, Jochen
Anker, Stefan D.
Lainscak, Mitja
author_sort Trobec, Katja
collection PubMed
description Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut function and decreased subcutaneous tissue may influence the absorption of orally and transdermally applied drugs. Altered body composition and plasma protein concentration may affect drug distribution. Changes in the expression and function of metabolic enzymes could influence the metabolism of drugs, and their renal excretion could be affected by possible reduction in kidney function. Because no general guidelines exist for drug dose adjustments in cachectic patients, we conducted a systematic search to identify articles that investigated the pharmacokinetics of drugs in cachectic patients.
format Online
Article
Text
id pubmed-3835942
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-38359422013-11-26 Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review Trobec, Katja Kerec Kos, Mojca von Haehling, Stephan Springer, Jochen Anker, Stefan D. Lainscak, Mitja PLoS One Research Article Cachexia is a weight-loss process caused by an underlying chronic disease such as cancer, chronic heart failure, chronic obstructive pulmonary disease, or rheumatoid arthritis. It leads to changes in body structure and function that may influence the pharmacokinetics of drugs. Changes in gut function and decreased subcutaneous tissue may influence the absorption of orally and transdermally applied drugs. Altered body composition and plasma protein concentration may affect drug distribution. Changes in the expression and function of metabolic enzymes could influence the metabolism of drugs, and their renal excretion could be affected by possible reduction in kidney function. Because no general guidelines exist for drug dose adjustments in cachectic patients, we conducted a systematic search to identify articles that investigated the pharmacokinetics of drugs in cachectic patients. Public Library of Science 2013-11-08 /pmc/articles/PMC3835942/ /pubmed/24282510 http://dx.doi.org/10.1371/journal.pone.0079603 Text en © 2013 Trobec et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Trobec, Katja
Kerec Kos, Mojca
von Haehling, Stephan
Springer, Jochen
Anker, Stefan D.
Lainscak, Mitja
Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review
title Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review
title_full Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review
title_fullStr Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review
title_full_unstemmed Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review
title_short Pharmacokinetics of Drugs in Cachectic Patients: A Systematic Review
title_sort pharmacokinetics of drugs in cachectic patients: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3835942/
https://www.ncbi.nlm.nih.gov/pubmed/24282510
http://dx.doi.org/10.1371/journal.pone.0079603
work_keys_str_mv AT trobeckatja pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT kereckosmojca pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT vonhaehlingstephan pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT springerjochen pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT ankerstefand pharmacokineticsofdrugsincachecticpatientsasystematicreview
AT lainscakmitja pharmacokineticsofdrugsincachecticpatientsasystematicreview