Cargando…

Molecular analysis of a consanguineous Iranian polycystic kidney disease family identifies a PKD2 mutation that aids diagnostics

BACKGROUND: Polycystic kidney diseases (PKD) are a group of monogenic disorders that are inherited dominantly (autosomal dominant PKD; ADPKD) or recessively, including, autosomal recessive PKD (ARPKD). A number of recessive, syndromic disorders also involve PKD but have a range of pleiotropic phenot...

Descripción completa

Detalles Bibliográficos
Autores principales: Vazifehmand, Reza, Rossetti, Sandro, Saber, Sassan, Khorshid, Hamid Reza Khorram, Harris, Peter C
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3846117/
https://www.ncbi.nlm.nih.gov/pubmed/24011172
http://dx.doi.org/10.1186/1471-2369-14-190
_version_ 1782293383836860416
author Vazifehmand, Reza
Rossetti, Sandro
Saber, Sassan
Khorshid, Hamid Reza Khorram
Harris, Peter C
author_facet Vazifehmand, Reza
Rossetti, Sandro
Saber, Sassan
Khorshid, Hamid Reza Khorram
Harris, Peter C
author_sort Vazifehmand, Reza
collection PubMed
description BACKGROUND: Polycystic kidney diseases (PKD) are a group of monogenic disorders that are inherited dominantly (autosomal dominant PKD; ADPKD) or recessively, including, autosomal recessive PKD (ARPKD). A number of recessive, syndromic disorders also involve PKD but have a range of pleiotropic phenotypes beyond the kidney, and are enriched in consanguineous families. CASE PRESENTATION: We describe here a consanguineous Iranian pedigree in which PKD was diagnosed in four generations, but also included cases with additional abnormalities, including mental retardation. We employed molecular screening to reveal the etiology of the PKD. Since the PKD seemed to be dominantly inherited, molecular diagnostics was performed by direct sequencing of the ADPKD genes, PKD1 and PKD2. Clinical and imaging data was collected on family members. The sequence analysis revealed a PKD2 single base-pair deletion, c.1142delG, and segregation was demonstrated in 16 PKD patients from different branches of the family. In keeping with other reports, the PKD2 phenotype in this family was overall mild, and characterized by conserved kidney function, although 12 cases had some evidence of renal insufficiency. Several younger mutation carriers had borderline or no clinical characteristics of ADPKD, while a patient that required a renal transplant at 14 y did not have the PKD2 mutation. CONCLUSIONS: The molecular analysis of an Iranian family showed that the PKD was due to a PKD2 mutation. The identification of the causative mutation allowed an accurate diagnosis in a number of individuals with equivocal imaging data. Consequently, these patients could be followed appropriately as at-risk individuals. In addition, the PKD2 diagnosis ruled out a syndromic form of PKD as the cause of the additional phenotypes in the family.
format Online
Article
Text
id pubmed-3846117
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-38461172013-12-03 Molecular analysis of a consanguineous Iranian polycystic kidney disease family identifies a PKD2 mutation that aids diagnostics Vazifehmand, Reza Rossetti, Sandro Saber, Sassan Khorshid, Hamid Reza Khorram Harris, Peter C BMC Nephrol Case Report BACKGROUND: Polycystic kidney diseases (PKD) are a group of monogenic disorders that are inherited dominantly (autosomal dominant PKD; ADPKD) or recessively, including, autosomal recessive PKD (ARPKD). A number of recessive, syndromic disorders also involve PKD but have a range of pleiotropic phenotypes beyond the kidney, and are enriched in consanguineous families. CASE PRESENTATION: We describe here a consanguineous Iranian pedigree in which PKD was diagnosed in four generations, but also included cases with additional abnormalities, including mental retardation. We employed molecular screening to reveal the etiology of the PKD. Since the PKD seemed to be dominantly inherited, molecular diagnostics was performed by direct sequencing of the ADPKD genes, PKD1 and PKD2. Clinical and imaging data was collected on family members. The sequence analysis revealed a PKD2 single base-pair deletion, c.1142delG, and segregation was demonstrated in 16 PKD patients from different branches of the family. In keeping with other reports, the PKD2 phenotype in this family was overall mild, and characterized by conserved kidney function, although 12 cases had some evidence of renal insufficiency. Several younger mutation carriers had borderline or no clinical characteristics of ADPKD, while a patient that required a renal transplant at 14 y did not have the PKD2 mutation. CONCLUSIONS: The molecular analysis of an Iranian family showed that the PKD was due to a PKD2 mutation. The identification of the causative mutation allowed an accurate diagnosis in a number of individuals with equivocal imaging data. Consequently, these patients could be followed appropriately as at-risk individuals. In addition, the PKD2 diagnosis ruled out a syndromic form of PKD as the cause of the additional phenotypes in the family. BioMed Central 2013-09-08 /pmc/articles/PMC3846117/ /pubmed/24011172 http://dx.doi.org/10.1186/1471-2369-14-190 Text en Copyright © 2013 Vazifehmand et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Case Report
Vazifehmand, Reza
Rossetti, Sandro
Saber, Sassan
Khorshid, Hamid Reza Khorram
Harris, Peter C
Molecular analysis of a consanguineous Iranian polycystic kidney disease family identifies a PKD2 mutation that aids diagnostics
title Molecular analysis of a consanguineous Iranian polycystic kidney disease family identifies a PKD2 mutation that aids diagnostics
title_full Molecular analysis of a consanguineous Iranian polycystic kidney disease family identifies a PKD2 mutation that aids diagnostics
title_fullStr Molecular analysis of a consanguineous Iranian polycystic kidney disease family identifies a PKD2 mutation that aids diagnostics
title_full_unstemmed Molecular analysis of a consanguineous Iranian polycystic kidney disease family identifies a PKD2 mutation that aids diagnostics
title_short Molecular analysis of a consanguineous Iranian polycystic kidney disease family identifies a PKD2 mutation that aids diagnostics
title_sort molecular analysis of a consanguineous iranian polycystic kidney disease family identifies a pkd2 mutation that aids diagnostics
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3846117/
https://www.ncbi.nlm.nih.gov/pubmed/24011172
http://dx.doi.org/10.1186/1471-2369-14-190
work_keys_str_mv AT vazifehmandreza molecularanalysisofaconsanguineousiranianpolycystickidneydiseasefamilyidentifiesapkd2mutationthataidsdiagnostics
AT rossettisandro molecularanalysisofaconsanguineousiranianpolycystickidneydiseasefamilyidentifiesapkd2mutationthataidsdiagnostics
AT sabersassan molecularanalysisofaconsanguineousiranianpolycystickidneydiseasefamilyidentifiesapkd2mutationthataidsdiagnostics
AT khorshidhamidrezakhorram molecularanalysisofaconsanguineousiranianpolycystickidneydiseasefamilyidentifiesapkd2mutationthataidsdiagnostics
AT harrispeterc molecularanalysisofaconsanguineousiranianpolycystickidneydiseasefamilyidentifiesapkd2mutationthataidsdiagnostics