Cargando…

Family physician practice visits arising from the Alberta Physician Achievement Review

BACKGROUND: Licensed physicians in Alberta are required to participate in the Physician Achievement Review (PAR) program every 5 years, comprising multi-source feedback questionnaires with confidential feedback, and practice visits for a minority of physicians. We wished to identify and classify iss...

Descripción completa

Detalles Bibliográficos
Autores principales: Lewkonia, Ray, Flook, Nigel, Donoff, Michel, Lockyer, Jocelyn
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3846577/
https://www.ncbi.nlm.nih.gov/pubmed/24010980
http://dx.doi.org/10.1186/1472-6920-13-121
_version_ 1782293449738813440
author Lewkonia, Ray
Flook, Nigel
Donoff, Michel
Lockyer, Jocelyn
author_facet Lewkonia, Ray
Flook, Nigel
Donoff, Michel
Lockyer, Jocelyn
author_sort Lewkonia, Ray
collection PubMed
description BACKGROUND: Licensed physicians in Alberta are required to participate in the Physician Achievement Review (PAR) program every 5 years, comprising multi-source feedback questionnaires with confidential feedback, and practice visits for a minority of physicians. We wished to identify and classify issues requiring change or improvement from the family practice visits, and the responses to advice. METHODS: Retrospective analysis of narrative practice visit reports data using a mixed methods design to study records of visits to 51 family physicians and general practitioners who participated in PAR during the period 2010 to 2011, and whose ratings in one or more major assessment domains were significantly lower than their peer group. RESULTS: Reports from visits to the practices of family physicians and general practitioners confirmed opportunities for change and improvement, with two main groupings – practice environment and physician performance. For 40/51 physicians (78%) suggested actions were discussed with physicians and changes were confirmed. Areas of particular concern included problems arising from practice isolation and diagnostic conclusions being reached with incomplete clinical evidence. CONCLUSION: This study provides additional evidence for the construct validity of a regulatory authority educational program in which multi-source performance feedback identifies areas for practice quality improvement, and change is encouraged by supplementary contact for selected physicians.
format Online
Article
Text
id pubmed-3846577
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-38465772013-12-03 Family physician practice visits arising from the Alberta Physician Achievement Review Lewkonia, Ray Flook, Nigel Donoff, Michel Lockyer, Jocelyn BMC Med Educ Research Article BACKGROUND: Licensed physicians in Alberta are required to participate in the Physician Achievement Review (PAR) program every 5 years, comprising multi-source feedback questionnaires with confidential feedback, and practice visits for a minority of physicians. We wished to identify and classify issues requiring change or improvement from the family practice visits, and the responses to advice. METHODS: Retrospective analysis of narrative practice visit reports data using a mixed methods design to study records of visits to 51 family physicians and general practitioners who participated in PAR during the period 2010 to 2011, and whose ratings in one or more major assessment domains were significantly lower than their peer group. RESULTS: Reports from visits to the practices of family physicians and general practitioners confirmed opportunities for change and improvement, with two main groupings – practice environment and physician performance. For 40/51 physicians (78%) suggested actions were discussed with physicians and changes were confirmed. Areas of particular concern included problems arising from practice isolation and diagnostic conclusions being reached with incomplete clinical evidence. CONCLUSION: This study provides additional evidence for the construct validity of a regulatory authority educational program in which multi-source performance feedback identifies areas for practice quality improvement, and change is encouraged by supplementary contact for selected physicians. BioMed Central 2013-09-09 /pmc/articles/PMC3846577/ /pubmed/24010980 http://dx.doi.org/10.1186/1472-6920-13-121 Text en Copyright © 2013 Lewkonia et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Lewkonia, Ray
Flook, Nigel
Donoff, Michel
Lockyer, Jocelyn
Family physician practice visits arising from the Alberta Physician Achievement Review
title Family physician practice visits arising from the Alberta Physician Achievement Review
title_full Family physician practice visits arising from the Alberta Physician Achievement Review
title_fullStr Family physician practice visits arising from the Alberta Physician Achievement Review
title_full_unstemmed Family physician practice visits arising from the Alberta Physician Achievement Review
title_short Family physician practice visits arising from the Alberta Physician Achievement Review
title_sort family physician practice visits arising from the alberta physician achievement review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3846577/
https://www.ncbi.nlm.nih.gov/pubmed/24010980
http://dx.doi.org/10.1186/1472-6920-13-121
work_keys_str_mv AT lewkoniaray familyphysicianpracticevisitsarisingfromthealbertaphysicianachievementreview
AT flooknigel familyphysicianpracticevisitsarisingfromthealbertaphysicianachievementreview
AT donoffmichel familyphysicianpracticevisitsarisingfromthealbertaphysicianachievementreview
AT lockyerjocelyn familyphysicianpracticevisitsarisingfromthealbertaphysicianachievementreview