Cargando…
Persistent Autoantibody-Production by Intermediates between Short-and Long-Lived Plasma Cells in Inflamed Lymph Nodes of Experimental Epidermolysis Bullosa Acquisita
Autoantibodies are believed to be maintained by either the continuous generation of short-lived plasma cells in secondary lymphoid tissues or by long-lived plasma cells localized in bone marrow and spleen. Here, we show in a mouse model for the autoimmune blistering skin disease epidermolysis bullos...
Autores principales: | , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3873383/ https://www.ncbi.nlm.nih.gov/pubmed/24386241 http://dx.doi.org/10.1371/journal.pone.0083631 |
_version_ | 1782297103141175296 |
---|---|
author | Tiburzy, Benjamin Szyska, Martin Iwata, Hiroaki Chrobok, Navina Kulkarni, Upasana Hirose, Misa Ludwig, Ralf J. Kalies, Kathrin Westermann, Jürgen Wong, David Manz, Rudolf Armin |
author_facet | Tiburzy, Benjamin Szyska, Martin Iwata, Hiroaki Chrobok, Navina Kulkarni, Upasana Hirose, Misa Ludwig, Ralf J. Kalies, Kathrin Westermann, Jürgen Wong, David Manz, Rudolf Armin |
author_sort | Tiburzy, Benjamin |
collection | PubMed |
description | Autoantibodies are believed to be maintained by either the continuous generation of short-lived plasma cells in secondary lymphoid tissues or by long-lived plasma cells localized in bone marrow and spleen. Here, we show in a mouse model for the autoimmune blistering skin disease epidermolysis bullosa acquisita (EBA) that chronic autoantibody production can also be maintained in inflamed lymph nodes, by plasma cells exhibiting intermediate lifetimes. After EBA induction by immunization with a mCOL7c-GST-fusion protein, antigen-specific plasma cells and CD4 T cells were analyzed. Plasma cells were maintained for months in stable numbers in the draining lymph nodes, but not in spleen and bone marrow. In contrast, localization of mCOL7c-GST -specific CD4 T cells was not restricted to lymph nodes, indicating that availability of T cell help does not limit plasma cell localization to this site. BrdU-incorporation studies indicated that pathogenic mCOL7c- and non-pathogenic GST-specific plasma cells resemble intermediates between short-and long-lived plasma cells with half-lives of about 7 weeks. Immunization with mCOL7c-GST also yielded considerable numbers of plasma cells neither specific for mCOL7c- nor GST. These bystander-activated plasma cells exhibited much shorter half-lives and higher population turnover, suggesting that plasma cell lifetimes were only partly determined by the lymph node environment but also by the mode of activation. These results indicate that inflamed lymph nodes can harbor pathogenic plasma cells exhibiting distinct properties and hence may resemble a so far neglected site for chronic autoantibody production. |
format | Online Article Text |
id | pubmed-3873383 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-38733832014-01-02 Persistent Autoantibody-Production by Intermediates between Short-and Long-Lived Plasma Cells in Inflamed Lymph Nodes of Experimental Epidermolysis Bullosa Acquisita Tiburzy, Benjamin Szyska, Martin Iwata, Hiroaki Chrobok, Navina Kulkarni, Upasana Hirose, Misa Ludwig, Ralf J. Kalies, Kathrin Westermann, Jürgen Wong, David Manz, Rudolf Armin PLoS One Research Article Autoantibodies are believed to be maintained by either the continuous generation of short-lived plasma cells in secondary lymphoid tissues or by long-lived plasma cells localized in bone marrow and spleen. Here, we show in a mouse model for the autoimmune blistering skin disease epidermolysis bullosa acquisita (EBA) that chronic autoantibody production can also be maintained in inflamed lymph nodes, by plasma cells exhibiting intermediate lifetimes. After EBA induction by immunization with a mCOL7c-GST-fusion protein, antigen-specific plasma cells and CD4 T cells were analyzed. Plasma cells were maintained for months in stable numbers in the draining lymph nodes, but not in spleen and bone marrow. In contrast, localization of mCOL7c-GST -specific CD4 T cells was not restricted to lymph nodes, indicating that availability of T cell help does not limit plasma cell localization to this site. BrdU-incorporation studies indicated that pathogenic mCOL7c- and non-pathogenic GST-specific plasma cells resemble intermediates between short-and long-lived plasma cells with half-lives of about 7 weeks. Immunization with mCOL7c-GST also yielded considerable numbers of plasma cells neither specific for mCOL7c- nor GST. These bystander-activated plasma cells exhibited much shorter half-lives and higher population turnover, suggesting that plasma cell lifetimes were only partly determined by the lymph node environment but also by the mode of activation. These results indicate that inflamed lymph nodes can harbor pathogenic plasma cells exhibiting distinct properties and hence may resemble a so far neglected site for chronic autoantibody production. Public Library of Science 2013-12-26 /pmc/articles/PMC3873383/ /pubmed/24386241 http://dx.doi.org/10.1371/journal.pone.0083631 Text en © 2013 Tiburzy et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Tiburzy, Benjamin Szyska, Martin Iwata, Hiroaki Chrobok, Navina Kulkarni, Upasana Hirose, Misa Ludwig, Ralf J. Kalies, Kathrin Westermann, Jürgen Wong, David Manz, Rudolf Armin Persistent Autoantibody-Production by Intermediates between Short-and Long-Lived Plasma Cells in Inflamed Lymph Nodes of Experimental Epidermolysis Bullosa Acquisita |
title | Persistent Autoantibody-Production by Intermediates between Short-and Long-Lived Plasma Cells in Inflamed Lymph Nodes of Experimental Epidermolysis Bullosa Acquisita |
title_full | Persistent Autoantibody-Production by Intermediates between Short-and Long-Lived Plasma Cells in Inflamed Lymph Nodes of Experimental Epidermolysis Bullosa Acquisita |
title_fullStr | Persistent Autoantibody-Production by Intermediates between Short-and Long-Lived Plasma Cells in Inflamed Lymph Nodes of Experimental Epidermolysis Bullosa Acquisita |
title_full_unstemmed | Persistent Autoantibody-Production by Intermediates between Short-and Long-Lived Plasma Cells in Inflamed Lymph Nodes of Experimental Epidermolysis Bullosa Acquisita |
title_short | Persistent Autoantibody-Production by Intermediates between Short-and Long-Lived Plasma Cells in Inflamed Lymph Nodes of Experimental Epidermolysis Bullosa Acquisita |
title_sort | persistent autoantibody-production by intermediates between short-and long-lived plasma cells in inflamed lymph nodes of experimental epidermolysis bullosa acquisita |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3873383/ https://www.ncbi.nlm.nih.gov/pubmed/24386241 http://dx.doi.org/10.1371/journal.pone.0083631 |
work_keys_str_mv | AT tiburzybenjamin persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT szyskamartin persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT iwatahiroaki persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT chroboknavina persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT kulkarniupasana persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT hirosemisa persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT ludwigralfj persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT kalieskathrin persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT westermannjurgen persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT wongdavid persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita AT manzrudolfarmin persistentautoantibodyproductionbyintermediatesbetweenshortandlonglivedplasmacellsininflamedlymphnodesofexperimentalepidermolysisbullosaacquisita |