Cargando…

First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family

BACKGROUND: Hemoglobin Shepherds Bush (Human Genome Variation Society name: HBB:c.224G > A) is an unstable hemoglobin variant resulting from a β 74 GGC to GAC mutation (Gly to Asp) that manifests clinically as hemolytic anemia or gall bladder disease due to chronic subclinical hemolysis. CASE PRE...

Descripción completa

Detalles Bibliográficos
Autores principales: Paradise, Scott L, Estep, Lauren, Olson, Jordan, Donaldson, Keri
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3898211/
https://www.ncbi.nlm.nih.gov/pubmed/24428873
http://dx.doi.org/10.1186/1472-6890-14-4
_version_ 1782300381105094656
author Paradise, Scott L
Estep, Lauren
Olson, Jordan
Donaldson, Keri
author_facet Paradise, Scott L
Estep, Lauren
Olson, Jordan
Donaldson, Keri
author_sort Paradise, Scott L
collection PubMed
description BACKGROUND: Hemoglobin Shepherds Bush (Human Genome Variation Society name: HBB:c.224G > A) is an unstable hemoglobin variant resulting from a β 74 GGC to GAC mutation (Gly to Asp) that manifests clinically as hemolytic anemia or gall bladder disease due to chronic subclinical hemolysis. CASE PRESENTATION: We report a Pennsylvania family of English descent with this condition, first noticed in a 6-year-old female. The proband presented with splenomegaly, fatigue, dark urine and an elevated indirect bilirubin. Hemoglobin identification studies and subsequent genetic testing performed according to a systematic algorithm elucidated the diagnosis of Hb Shepherds Bush. CONCLUSIONS: This is the first case of this rare hemoglobin variant identified in North America to our knowledge. It was identified using a systematic algorithm of diagnostic tests that should be followed whenever considering a rare hemoglobinopathy as part of the differential diagnosis.
format Online
Article
Text
id pubmed-3898211
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-38982112014-01-23 First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family Paradise, Scott L Estep, Lauren Olson, Jordan Donaldson, Keri BMC Clin Pathol Case Report BACKGROUND: Hemoglobin Shepherds Bush (Human Genome Variation Society name: HBB:c.224G > A) is an unstable hemoglobin variant resulting from a β 74 GGC to GAC mutation (Gly to Asp) that manifests clinically as hemolytic anemia or gall bladder disease due to chronic subclinical hemolysis. CASE PRESENTATION: We report a Pennsylvania family of English descent with this condition, first noticed in a 6-year-old female. The proband presented with splenomegaly, fatigue, dark urine and an elevated indirect bilirubin. Hemoglobin identification studies and subsequent genetic testing performed according to a systematic algorithm elucidated the diagnosis of Hb Shepherds Bush. CONCLUSIONS: This is the first case of this rare hemoglobin variant identified in North America to our knowledge. It was identified using a systematic algorithm of diagnostic tests that should be followed whenever considering a rare hemoglobinopathy as part of the differential diagnosis. BioMed Central 2014-01-15 /pmc/articles/PMC3898211/ /pubmed/24428873 http://dx.doi.org/10.1186/1472-6890-14-4 Text en Copyright © 2014 Paradise et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Paradise, Scott L
Estep, Lauren
Olson, Jordan
Donaldson, Keri
First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family
title First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family
title_full First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family
title_fullStr First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family
title_full_unstemmed First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family
title_short First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family
title_sort first north american case of hemoglobin shepherds bush (β 74[e18] gly → asp) in a central pennsylvania family
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3898211/
https://www.ncbi.nlm.nih.gov/pubmed/24428873
http://dx.doi.org/10.1186/1472-6890-14-4
work_keys_str_mv AT paradisescottl firstnorthamericancaseofhemoglobinshepherdsbushb74e18glyaspinacentralpennsylvaniafamily
AT esteplauren firstnorthamericancaseofhemoglobinshepherdsbushb74e18glyaspinacentralpennsylvaniafamily
AT olsonjordan firstnorthamericancaseofhemoglobinshepherdsbushb74e18glyaspinacentralpennsylvaniafamily
AT donaldsonkeri firstnorthamericancaseofhemoglobinshepherdsbushb74e18glyaspinacentralpennsylvaniafamily