Cargando…
First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family
BACKGROUND: Hemoglobin Shepherds Bush (Human Genome Variation Society name: HBB:c.224G > A) is an unstable hemoglobin variant resulting from a β 74 GGC to GAC mutation (Gly to Asp) that manifests clinically as hemolytic anemia or gall bladder disease due to chronic subclinical hemolysis. CASE PRE...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3898211/ https://www.ncbi.nlm.nih.gov/pubmed/24428873 http://dx.doi.org/10.1186/1472-6890-14-4 |
_version_ | 1782300381105094656 |
---|---|
author | Paradise, Scott L Estep, Lauren Olson, Jordan Donaldson, Keri |
author_facet | Paradise, Scott L Estep, Lauren Olson, Jordan Donaldson, Keri |
author_sort | Paradise, Scott L |
collection | PubMed |
description | BACKGROUND: Hemoglobin Shepherds Bush (Human Genome Variation Society name: HBB:c.224G > A) is an unstable hemoglobin variant resulting from a β 74 GGC to GAC mutation (Gly to Asp) that manifests clinically as hemolytic anemia or gall bladder disease due to chronic subclinical hemolysis. CASE PRESENTATION: We report a Pennsylvania family of English descent with this condition, first noticed in a 6-year-old female. The proband presented with splenomegaly, fatigue, dark urine and an elevated indirect bilirubin. Hemoglobin identification studies and subsequent genetic testing performed according to a systematic algorithm elucidated the diagnosis of Hb Shepherds Bush. CONCLUSIONS: This is the first case of this rare hemoglobin variant identified in North America to our knowledge. It was identified using a systematic algorithm of diagnostic tests that should be followed whenever considering a rare hemoglobinopathy as part of the differential diagnosis. |
format | Online Article Text |
id | pubmed-3898211 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-38982112014-01-23 First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family Paradise, Scott L Estep, Lauren Olson, Jordan Donaldson, Keri BMC Clin Pathol Case Report BACKGROUND: Hemoglobin Shepherds Bush (Human Genome Variation Society name: HBB:c.224G > A) is an unstable hemoglobin variant resulting from a β 74 GGC to GAC mutation (Gly to Asp) that manifests clinically as hemolytic anemia or gall bladder disease due to chronic subclinical hemolysis. CASE PRESENTATION: We report a Pennsylvania family of English descent with this condition, first noticed in a 6-year-old female. The proband presented with splenomegaly, fatigue, dark urine and an elevated indirect bilirubin. Hemoglobin identification studies and subsequent genetic testing performed according to a systematic algorithm elucidated the diagnosis of Hb Shepherds Bush. CONCLUSIONS: This is the first case of this rare hemoglobin variant identified in North America to our knowledge. It was identified using a systematic algorithm of diagnostic tests that should be followed whenever considering a rare hemoglobinopathy as part of the differential diagnosis. BioMed Central 2014-01-15 /pmc/articles/PMC3898211/ /pubmed/24428873 http://dx.doi.org/10.1186/1472-6890-14-4 Text en Copyright © 2014 Paradise et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Paradise, Scott L Estep, Lauren Olson, Jordan Donaldson, Keri First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family |
title | First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family |
title_full | First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family |
title_fullStr | First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family |
title_full_unstemmed | First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family |
title_short | First North American case of Hemoglobin Shepherds Bush (β 74[E18] Gly → Asp) in a central Pennsylvania family |
title_sort | first north american case of hemoglobin shepherds bush (β 74[e18] gly → asp) in a central pennsylvania family |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3898211/ https://www.ncbi.nlm.nih.gov/pubmed/24428873 http://dx.doi.org/10.1186/1472-6890-14-4 |
work_keys_str_mv | AT paradisescottl firstnorthamericancaseofhemoglobinshepherdsbushb74e18glyaspinacentralpennsylvaniafamily AT esteplauren firstnorthamericancaseofhemoglobinshepherdsbushb74e18glyaspinacentralpennsylvaniafamily AT olsonjordan firstnorthamericancaseofhemoglobinshepherdsbushb74e18glyaspinacentralpennsylvaniafamily AT donaldsonkeri firstnorthamericancaseofhemoglobinshepherdsbushb74e18glyaspinacentralpennsylvaniafamily |