Cargando…

Epidemiology and genetic diversity of Taenia asiatica: a systematic review

Taenia asiatica has made a remarkable journey through the scientific literature of the past 50 years, starting with the paradoxical observation of high prevalences of T. saginata-like tapeworms in non-beef consuming populations, to the full description of its mitochondrial genome. Experimental studi...

Descripción completa

Detalles Bibliográficos
Autores principales: Ale, Anita, Victor, Bjorn, Praet, Nicolas, Gabriël, Sarah, Speybroeck, Niko, Dorny, Pierre, Devleesschauwer, Brecht
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3900737/
https://www.ncbi.nlm.nih.gov/pubmed/24450957
http://dx.doi.org/10.1186/1756-3305-7-45
_version_ 1782300749465649152
author Ale, Anita
Victor, Bjorn
Praet, Nicolas
Gabriël, Sarah
Speybroeck, Niko
Dorny, Pierre
Devleesschauwer, Brecht
author_facet Ale, Anita
Victor, Bjorn
Praet, Nicolas
Gabriël, Sarah
Speybroeck, Niko
Dorny, Pierre
Devleesschauwer, Brecht
author_sort Ale, Anita
collection PubMed
description Taenia asiatica has made a remarkable journey through the scientific literature of the past 50 years, starting with the paradoxical observation of high prevalences of T. saginata-like tapeworms in non-beef consuming populations, to the full description of its mitochondrial genome. Experimental studies conducted in the 1980s and 1990s have made it clear that the life cycle of T. asiatica is comparable to that of T. saginata, except for pigs being the preferential intermediate host and liver the preferential location of the cysts. Whether or not T. asiatica can cause human cysticercosis, as is the case for Taenia solium, remains unclear. Given the specific conditions needed to complete its life cycle, in particular the consumption of raw or poorly cooked pig liver, the transmission of T. asiatica shows an important ethno-geographical association. So far, T. asiatica has been identified in Taiwan, South Korea, Indonesia, the Philippines, Thailand, south-central China, Vietnam, Japan and Nepal. Especially this last observation indicates that its distribution is not restricted to South-East-Asia, as was thought so far. Indeed, the molecular tools developed over the last 20 years have made it increasingly possible to differentiate T. asiatica from other taeniids. Such tools also indicated that T. asiatica is related more closely to T. saginata than to T. solium, feeding the debate on its taxonomic status as a separate species versus a subspecies of T. saginata. Furthermore, the genetic diversity within T. asiatica appears to be very minimal, indicating that this parasite may be on the verge of extinction. However, recent studies have identified potential hybrids between T. asiatica and T. saginata, reopening the debate on the genetic diversity of T. asiatica and its status as a separate species.
format Online
Article
Text
id pubmed-3900737
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-39007372014-01-25 Epidemiology and genetic diversity of Taenia asiatica: a systematic review Ale, Anita Victor, Bjorn Praet, Nicolas Gabriël, Sarah Speybroeck, Niko Dorny, Pierre Devleesschauwer, Brecht Parasit Vectors Review Taenia asiatica has made a remarkable journey through the scientific literature of the past 50 years, starting with the paradoxical observation of high prevalences of T. saginata-like tapeworms in non-beef consuming populations, to the full description of its mitochondrial genome. Experimental studies conducted in the 1980s and 1990s have made it clear that the life cycle of T. asiatica is comparable to that of T. saginata, except for pigs being the preferential intermediate host and liver the preferential location of the cysts. Whether or not T. asiatica can cause human cysticercosis, as is the case for Taenia solium, remains unclear. Given the specific conditions needed to complete its life cycle, in particular the consumption of raw or poorly cooked pig liver, the transmission of T. asiatica shows an important ethno-geographical association. So far, T. asiatica has been identified in Taiwan, South Korea, Indonesia, the Philippines, Thailand, south-central China, Vietnam, Japan and Nepal. Especially this last observation indicates that its distribution is not restricted to South-East-Asia, as was thought so far. Indeed, the molecular tools developed over the last 20 years have made it increasingly possible to differentiate T. asiatica from other taeniids. Such tools also indicated that T. asiatica is related more closely to T. saginata than to T. solium, feeding the debate on its taxonomic status as a separate species versus a subspecies of T. saginata. Furthermore, the genetic diversity within T. asiatica appears to be very minimal, indicating that this parasite may be on the verge of extinction. However, recent studies have identified potential hybrids between T. asiatica and T. saginata, reopening the debate on the genetic diversity of T. asiatica and its status as a separate species. BioMed Central 2014-01-22 /pmc/articles/PMC3900737/ /pubmed/24450957 http://dx.doi.org/10.1186/1756-3305-7-45 Text en Copyright © 2014 Ale et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Review
Ale, Anita
Victor, Bjorn
Praet, Nicolas
Gabriël, Sarah
Speybroeck, Niko
Dorny, Pierre
Devleesschauwer, Brecht
Epidemiology and genetic diversity of Taenia asiatica: a systematic review
title Epidemiology and genetic diversity of Taenia asiatica: a systematic review
title_full Epidemiology and genetic diversity of Taenia asiatica: a systematic review
title_fullStr Epidemiology and genetic diversity of Taenia asiatica: a systematic review
title_full_unstemmed Epidemiology and genetic diversity of Taenia asiatica: a systematic review
title_short Epidemiology and genetic diversity of Taenia asiatica: a systematic review
title_sort epidemiology and genetic diversity of taenia asiatica: a systematic review
topic Review
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3900737/
https://www.ncbi.nlm.nih.gov/pubmed/24450957
http://dx.doi.org/10.1186/1756-3305-7-45
work_keys_str_mv AT aleanita epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview
AT victorbjorn epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview
AT praetnicolas epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview
AT gabrielsarah epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview
AT speybroeckniko epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview
AT dornypierre epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview
AT devleesschauwerbrecht epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview