Cargando…
Epidemiology and genetic diversity of Taenia asiatica: a systematic review
Taenia asiatica has made a remarkable journey through the scientific literature of the past 50 years, starting with the paradoxical observation of high prevalences of T. saginata-like tapeworms in non-beef consuming populations, to the full description of its mitochondrial genome. Experimental studi...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3900737/ https://www.ncbi.nlm.nih.gov/pubmed/24450957 http://dx.doi.org/10.1186/1756-3305-7-45 |
_version_ | 1782300749465649152 |
---|---|
author | Ale, Anita Victor, Bjorn Praet, Nicolas Gabriël, Sarah Speybroeck, Niko Dorny, Pierre Devleesschauwer, Brecht |
author_facet | Ale, Anita Victor, Bjorn Praet, Nicolas Gabriël, Sarah Speybroeck, Niko Dorny, Pierre Devleesschauwer, Brecht |
author_sort | Ale, Anita |
collection | PubMed |
description | Taenia asiatica has made a remarkable journey through the scientific literature of the past 50 years, starting with the paradoxical observation of high prevalences of T. saginata-like tapeworms in non-beef consuming populations, to the full description of its mitochondrial genome. Experimental studies conducted in the 1980s and 1990s have made it clear that the life cycle of T. asiatica is comparable to that of T. saginata, except for pigs being the preferential intermediate host and liver the preferential location of the cysts. Whether or not T. asiatica can cause human cysticercosis, as is the case for Taenia solium, remains unclear. Given the specific conditions needed to complete its life cycle, in particular the consumption of raw or poorly cooked pig liver, the transmission of T. asiatica shows an important ethno-geographical association. So far, T. asiatica has been identified in Taiwan, South Korea, Indonesia, the Philippines, Thailand, south-central China, Vietnam, Japan and Nepal. Especially this last observation indicates that its distribution is not restricted to South-East-Asia, as was thought so far. Indeed, the molecular tools developed over the last 20 years have made it increasingly possible to differentiate T. asiatica from other taeniids. Such tools also indicated that T. asiatica is related more closely to T. saginata than to T. solium, feeding the debate on its taxonomic status as a separate species versus a subspecies of T. saginata. Furthermore, the genetic diversity within T. asiatica appears to be very minimal, indicating that this parasite may be on the verge of extinction. However, recent studies have identified potential hybrids between T. asiatica and T. saginata, reopening the debate on the genetic diversity of T. asiatica and its status as a separate species. |
format | Online Article Text |
id | pubmed-3900737 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-39007372014-01-25 Epidemiology and genetic diversity of Taenia asiatica: a systematic review Ale, Anita Victor, Bjorn Praet, Nicolas Gabriël, Sarah Speybroeck, Niko Dorny, Pierre Devleesschauwer, Brecht Parasit Vectors Review Taenia asiatica has made a remarkable journey through the scientific literature of the past 50 years, starting with the paradoxical observation of high prevalences of T. saginata-like tapeworms in non-beef consuming populations, to the full description of its mitochondrial genome. Experimental studies conducted in the 1980s and 1990s have made it clear that the life cycle of T. asiatica is comparable to that of T. saginata, except for pigs being the preferential intermediate host and liver the preferential location of the cysts. Whether or not T. asiatica can cause human cysticercosis, as is the case for Taenia solium, remains unclear. Given the specific conditions needed to complete its life cycle, in particular the consumption of raw or poorly cooked pig liver, the transmission of T. asiatica shows an important ethno-geographical association. So far, T. asiatica has been identified in Taiwan, South Korea, Indonesia, the Philippines, Thailand, south-central China, Vietnam, Japan and Nepal. Especially this last observation indicates that its distribution is not restricted to South-East-Asia, as was thought so far. Indeed, the molecular tools developed over the last 20 years have made it increasingly possible to differentiate T. asiatica from other taeniids. Such tools also indicated that T. asiatica is related more closely to T. saginata than to T. solium, feeding the debate on its taxonomic status as a separate species versus a subspecies of T. saginata. Furthermore, the genetic diversity within T. asiatica appears to be very minimal, indicating that this parasite may be on the verge of extinction. However, recent studies have identified potential hybrids between T. asiatica and T. saginata, reopening the debate on the genetic diversity of T. asiatica and its status as a separate species. BioMed Central 2014-01-22 /pmc/articles/PMC3900737/ /pubmed/24450957 http://dx.doi.org/10.1186/1756-3305-7-45 Text en Copyright © 2014 Ale et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Review Ale, Anita Victor, Bjorn Praet, Nicolas Gabriël, Sarah Speybroeck, Niko Dorny, Pierre Devleesschauwer, Brecht Epidemiology and genetic diversity of Taenia asiatica: a systematic review |
title | Epidemiology and genetic diversity of Taenia asiatica: a systematic review |
title_full | Epidemiology and genetic diversity of Taenia asiatica: a systematic review |
title_fullStr | Epidemiology and genetic diversity of Taenia asiatica: a systematic review |
title_full_unstemmed | Epidemiology and genetic diversity of Taenia asiatica: a systematic review |
title_short | Epidemiology and genetic diversity of Taenia asiatica: a systematic review |
title_sort | epidemiology and genetic diversity of taenia asiatica: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3900737/ https://www.ncbi.nlm.nih.gov/pubmed/24450957 http://dx.doi.org/10.1186/1756-3305-7-45 |
work_keys_str_mv | AT aleanita epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview AT victorbjorn epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview AT praetnicolas epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview AT gabrielsarah epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview AT speybroeckniko epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview AT dornypierre epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview AT devleesschauwerbrecht epidemiologyandgeneticdiversityoftaeniaasiaticaasystematicreview |