Cargando…
Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels
BACKGROUND: Wilms tumor 1 (WT1) is over-expressed in numerous cancers with respect to normal cells, and has either a tumor suppressor or oncogenic role depending on cellular context. This gene is associated with numerous alternatively spliced transcripts, which initiate from two different unique fir...
Autores principales: | , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3900738/ https://www.ncbi.nlm.nih.gov/pubmed/24405639 http://dx.doi.org/10.1186/1756-8722-7-4 |
_version_ | 1782300749694238720 |
---|---|
author | Guillaumet-Adkins, Amy Richter, Julia Odero, Maria D Sandoval, Juan Agirre, Xabi Catala, Albert Esteller, Manel Prósper, Felipe Calasanz, María José Buño, Ismael Kwon, Mi Court, Franck Siebert, Reiner Monk, David |
author_facet | Guillaumet-Adkins, Amy Richter, Julia Odero, Maria D Sandoval, Juan Agirre, Xabi Catala, Albert Esteller, Manel Prósper, Felipe Calasanz, María José Buño, Ismael Kwon, Mi Court, Franck Siebert, Reiner Monk, David |
author_sort | Guillaumet-Adkins, Amy |
collection | PubMed |
description | BACKGROUND: Wilms tumor 1 (WT1) is over-expressed in numerous cancers with respect to normal cells, and has either a tumor suppressor or oncogenic role depending on cellular context. This gene is associated with numerous alternatively spliced transcripts, which initiate from two different unique first exons within the WT1 and the alternative (A)WT1 promoter intervals. Within the hematological system, WT1 expression is restricted to CD34+/CD38- cells and is undetectable after differentiation. Detectable expression of this gene is an excellent marker for minimal residual disease in acute myeloid leukemia (AML), but the underlying epigenetic alterations are unknown. METHODS: To determine the changes in the underlying epigenetic landscape responsible for this expression, we characterized expression, DNA methylation and histone modification profiles in 28 hematological cancer cell lines and confirmed the methylation signature in 356 cytogenetically well-characterized primary hematological malignancies. RESULTS: Despite high expression of WT1 and AWT1 transcripts in AML-derived cell lines, we observe robust hypermethylation of the AWT1 promoter and an epigenetic switch from a permissive to repressive chromatin structure between normal cells and AML cell lines. Subsequent methylation analysis in our primary leukemia and lymphoma cohort revealed that the epigenetic signature identified in cell lines is specific to myeloid-lineage malignancies, irrespective of underlying mutational status or translocation. In addition to being a highly specific marker for AML diagnosis (positive predictive value 100%; sensitivity 86.1%; negative predictive value 89.4%), we show that AWT1 hypermethylation also discriminates patients that relapse from those achieving complete remission after hematopoietic stem cell transplantation, with similar efficiency to WT1 expression profiling. CONCLUSIONS: We describe a methylation signature of the AWT1 promoter CpG island that is a promising marker for classifying myeloid-derived leukemias. In addition AWT1 hypermethylation is ideally suited to monitor the recurrence of disease during remission in patients undergoing allogeneic stem cell transfer. |
format | Online Article Text |
id | pubmed-3900738 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-39007382014-01-25 Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels Guillaumet-Adkins, Amy Richter, Julia Odero, Maria D Sandoval, Juan Agirre, Xabi Catala, Albert Esteller, Manel Prósper, Felipe Calasanz, María José Buño, Ismael Kwon, Mi Court, Franck Siebert, Reiner Monk, David J Hematol Oncol Research BACKGROUND: Wilms tumor 1 (WT1) is over-expressed in numerous cancers with respect to normal cells, and has either a tumor suppressor or oncogenic role depending on cellular context. This gene is associated with numerous alternatively spliced transcripts, which initiate from two different unique first exons within the WT1 and the alternative (A)WT1 promoter intervals. Within the hematological system, WT1 expression is restricted to CD34+/CD38- cells and is undetectable after differentiation. Detectable expression of this gene is an excellent marker for minimal residual disease in acute myeloid leukemia (AML), but the underlying epigenetic alterations are unknown. METHODS: To determine the changes in the underlying epigenetic landscape responsible for this expression, we characterized expression, DNA methylation and histone modification profiles in 28 hematological cancer cell lines and confirmed the methylation signature in 356 cytogenetically well-characterized primary hematological malignancies. RESULTS: Despite high expression of WT1 and AWT1 transcripts in AML-derived cell lines, we observe robust hypermethylation of the AWT1 promoter and an epigenetic switch from a permissive to repressive chromatin structure between normal cells and AML cell lines. Subsequent methylation analysis in our primary leukemia and lymphoma cohort revealed that the epigenetic signature identified in cell lines is specific to myeloid-lineage malignancies, irrespective of underlying mutational status or translocation. In addition to being a highly specific marker for AML diagnosis (positive predictive value 100%; sensitivity 86.1%; negative predictive value 89.4%), we show that AWT1 hypermethylation also discriminates patients that relapse from those achieving complete remission after hematopoietic stem cell transplantation, with similar efficiency to WT1 expression profiling. CONCLUSIONS: We describe a methylation signature of the AWT1 promoter CpG island that is a promising marker for classifying myeloid-derived leukemias. In addition AWT1 hypermethylation is ideally suited to monitor the recurrence of disease during remission in patients undergoing allogeneic stem cell transfer. BioMed Central 2014-01-09 /pmc/articles/PMC3900738/ /pubmed/24405639 http://dx.doi.org/10.1186/1756-8722-7-4 Text en Copyright © 2014 Guillaumet-Adkins et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Guillaumet-Adkins, Amy Richter, Julia Odero, Maria D Sandoval, Juan Agirre, Xabi Catala, Albert Esteller, Manel Prósper, Felipe Calasanz, María José Buño, Ismael Kwon, Mi Court, Franck Siebert, Reiner Monk, David Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels |
title | Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels |
title_full | Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels |
title_fullStr | Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels |
title_full_unstemmed | Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels |
title_short | Hypermethylation of the alternative AWT1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels |
title_sort | hypermethylation of the alternative awt1 promoter in hematological malignancies is a highly specific marker for acute myeloid leukemias despite high expression levels |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3900738/ https://www.ncbi.nlm.nih.gov/pubmed/24405639 http://dx.doi.org/10.1186/1756-8722-7-4 |
work_keys_str_mv | AT guillaumetadkinsamy hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT richterjulia hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT oderomariad hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT sandovaljuan hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT agirrexabi hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT catalaalbert hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT estellermanel hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT prosperfelipe hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT calasanzmariajose hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT bunoismael hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT kwonmi hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT courtfranck hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT siebertreiner hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels AT monkdavid hypermethylationofthealternativeawt1promoterinhematologicalmalignanciesisahighlyspecificmarkerforacutemyeloidleukemiasdespitehighexpressionlevels |