Cargando…

Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons

OBJECTIVE: In this work, role of the adrenergic nerve system (alpha(1) and beta(2)) in adjustment of the bronchomotor tonus in healthy people was researched. METHODS: Parameters of the lung function are determined by Body plethysmography. Raw and ITGV were registered and SRaw was calculated as well....

Descripción completa

Detalles Bibliográficos
Autores principales: Gashi, Njazi, Islami, Pëllumb, Mustafa, Lirim, Maloku, Halit, Veseli, Arta, Islami, Hilmi
Formato: Online Artículo Texto
Lenguaje:English
Publicado: AVICENA 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3916168/
https://www.ncbi.nlm.nih.gov/pubmed/24554803
http://dx.doi.org/10.5455/aim.2013.21.266-269
_version_ 1782302674071322624
author Gashi, Njazi
Islami, Pëllumb
Mustafa, Lirim
Maloku, Halit
Veseli, Arta
Islami, Hilmi
author_facet Gashi, Njazi
Islami, Pëllumb
Mustafa, Lirim
Maloku, Halit
Veseli, Arta
Islami, Hilmi
author_sort Gashi, Njazi
collection PubMed
description OBJECTIVE: In this work, role of the adrenergic nerve system (alpha(1) and beta(2)) in adjustment of the bronchomotor tonus in healthy people was researched. METHODS: Parameters of the lung function are determined by Body plethysmography. Raw and ITGV were registered and SRaw was calculated as well. Aerosolization is done with standard aerosolizing machines – Asema. RESULTS: Results gained shows that following the blockade of beta-(2) adrenergic receptor with Propranolol (20 mg–aerosol), stimulation of alpha adrenergic receptor with Oxedrine (120 mg-aerosol) and blockage of these receptors with Tolazoline (20 mg-aerosol), does not change significantly the bronchomotor tonus of the tracheobronchial tree (p > 0.1). Meanwhile, stimulation of the beta(-2) adrenergic receptor with Hexoprenaline (2 inh × 0.2 mg) is associated with a significant increase of the peripheral resistance of the airways (p < 0.01). CONCLUSION: This suggests that the activity of the alpha(1)-adrenergic receptor, unlike the activity of the beta(2)-adrenergic receptor in the healthy people smooth musculature, is not significant and as such is insufficient to oppose to the tonic activities of the cholinergic system.
format Online
Article
Text
id pubmed-3916168
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher AVICENA
record_format MEDLINE/PubMed
spelling pubmed-39161682014-02-19 Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons Gashi, Njazi Islami, Pëllumb Mustafa, Lirim Maloku, Halit Veseli, Arta Islami, Hilmi Acta Inform Med Original Paper OBJECTIVE: In this work, role of the adrenergic nerve system (alpha(1) and beta(2)) in adjustment of the bronchomotor tonus in healthy people was researched. METHODS: Parameters of the lung function are determined by Body plethysmography. Raw and ITGV were registered and SRaw was calculated as well. Aerosolization is done with standard aerosolizing machines – Asema. RESULTS: Results gained shows that following the blockade of beta-(2) adrenergic receptor with Propranolol (20 mg–aerosol), stimulation of alpha adrenergic receptor with Oxedrine (120 mg-aerosol) and blockage of these receptors with Tolazoline (20 mg-aerosol), does not change significantly the bronchomotor tonus of the tracheobronchial tree (p > 0.1). Meanwhile, stimulation of the beta(-2) adrenergic receptor with Hexoprenaline (2 inh × 0.2 mg) is associated with a significant increase of the peripheral resistance of the airways (p < 0.01). CONCLUSION: This suggests that the activity of the alpha(1)-adrenergic receptor, unlike the activity of the beta(2)-adrenergic receptor in the healthy people smooth musculature, is not significant and as such is insufficient to oppose to the tonic activities of the cholinergic system. AVICENA 2013-12-04 2013-12 /pmc/articles/PMC3916168/ /pubmed/24554803 http://dx.doi.org/10.5455/aim.2013.21.266-269 Text en © 2013 AVICENA http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Paper
Gashi, Njazi
Islami, Pëllumb
Mustafa, Lirim
Maloku, Halit
Veseli, Arta
Islami, Hilmi
Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons
title Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons
title_full Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons
title_fullStr Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons
title_full_unstemmed Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons
title_short Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons
title_sort activity of the adrenergic nerve system in the airways permeability of healthy persons
topic Original Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3916168/
https://www.ncbi.nlm.nih.gov/pubmed/24554803
http://dx.doi.org/10.5455/aim.2013.21.266-269
work_keys_str_mv AT gashinjazi activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons
AT islamipellumb activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons
AT mustafalirim activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons
AT malokuhalit activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons
AT veseliarta activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons
AT islamihilmi activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons