Cargando…
Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons
OBJECTIVE: In this work, role of the adrenergic nerve system (alpha(1) and beta(2)) in adjustment of the bronchomotor tonus in healthy people was researched. METHODS: Parameters of the lung function are determined by Body plethysmography. Raw and ITGV were registered and SRaw was calculated as well....
Autores principales: | , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
AVICENA
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3916168/ https://www.ncbi.nlm.nih.gov/pubmed/24554803 http://dx.doi.org/10.5455/aim.2013.21.266-269 |
_version_ | 1782302674071322624 |
---|---|
author | Gashi, Njazi Islami, Pëllumb Mustafa, Lirim Maloku, Halit Veseli, Arta Islami, Hilmi |
author_facet | Gashi, Njazi Islami, Pëllumb Mustafa, Lirim Maloku, Halit Veseli, Arta Islami, Hilmi |
author_sort | Gashi, Njazi |
collection | PubMed |
description | OBJECTIVE: In this work, role of the adrenergic nerve system (alpha(1) and beta(2)) in adjustment of the bronchomotor tonus in healthy people was researched. METHODS: Parameters of the lung function are determined by Body plethysmography. Raw and ITGV were registered and SRaw was calculated as well. Aerosolization is done with standard aerosolizing machines – Asema. RESULTS: Results gained shows that following the blockade of beta-(2) adrenergic receptor with Propranolol (20 mg–aerosol), stimulation of alpha adrenergic receptor with Oxedrine (120 mg-aerosol) and blockage of these receptors with Tolazoline (20 mg-aerosol), does not change significantly the bronchomotor tonus of the tracheobronchial tree (p > 0.1). Meanwhile, stimulation of the beta(-2) adrenergic receptor with Hexoprenaline (2 inh × 0.2 mg) is associated with a significant increase of the peripheral resistance of the airways (p < 0.01). CONCLUSION: This suggests that the activity of the alpha(1)-adrenergic receptor, unlike the activity of the beta(2)-adrenergic receptor in the healthy people smooth musculature, is not significant and as such is insufficient to oppose to the tonic activities of the cholinergic system. |
format | Online Article Text |
id | pubmed-3916168 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | AVICENA |
record_format | MEDLINE/PubMed |
spelling | pubmed-39161682014-02-19 Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons Gashi, Njazi Islami, Pëllumb Mustafa, Lirim Maloku, Halit Veseli, Arta Islami, Hilmi Acta Inform Med Original Paper OBJECTIVE: In this work, role of the adrenergic nerve system (alpha(1) and beta(2)) in adjustment of the bronchomotor tonus in healthy people was researched. METHODS: Parameters of the lung function are determined by Body plethysmography. Raw and ITGV were registered and SRaw was calculated as well. Aerosolization is done with standard aerosolizing machines – Asema. RESULTS: Results gained shows that following the blockade of beta-(2) adrenergic receptor with Propranolol (20 mg–aerosol), stimulation of alpha adrenergic receptor with Oxedrine (120 mg-aerosol) and blockage of these receptors with Tolazoline (20 mg-aerosol), does not change significantly the bronchomotor tonus of the tracheobronchial tree (p > 0.1). Meanwhile, stimulation of the beta(-2) adrenergic receptor with Hexoprenaline (2 inh × 0.2 mg) is associated with a significant increase of the peripheral resistance of the airways (p < 0.01). CONCLUSION: This suggests that the activity of the alpha(1)-adrenergic receptor, unlike the activity of the beta(2)-adrenergic receptor in the healthy people smooth musculature, is not significant and as such is insufficient to oppose to the tonic activities of the cholinergic system. AVICENA 2013-12-04 2013-12 /pmc/articles/PMC3916168/ /pubmed/24554803 http://dx.doi.org/10.5455/aim.2013.21.266-269 Text en © 2013 AVICENA http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Paper Gashi, Njazi Islami, Pëllumb Mustafa, Lirim Maloku, Halit Veseli, Arta Islami, Hilmi Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons |
title | Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons |
title_full | Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons |
title_fullStr | Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons |
title_full_unstemmed | Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons |
title_short | Activity of the Adrenergic Nerve System in the Airways Permeability of Healthy Persons |
title_sort | activity of the adrenergic nerve system in the airways permeability of healthy persons |
topic | Original Paper |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3916168/ https://www.ncbi.nlm.nih.gov/pubmed/24554803 http://dx.doi.org/10.5455/aim.2013.21.266-269 |
work_keys_str_mv | AT gashinjazi activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons AT islamipellumb activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons AT mustafalirim activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons AT malokuhalit activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons AT veseliarta activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons AT islamihilmi activityoftheadrenergicnervesystemintheairwayspermeabilityofhealthypersons |