Cargando…
Nutrition Prescription to Achieve Positive Outcomes in Chronic Kidney Disease: A Systematic Review
In Chronic Kidney Disease (CKD), management of diet is important in prevention of disease progression and symptom management, however evidence on nutrition prescription is limited. Recent international CKD guidelines and literature was reviewed to address the following question “What is the appropri...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3916870/ https://www.ncbi.nlm.nih.gov/pubmed/24451311 http://dx.doi.org/10.3390/nu6010416 |
_version_ | 1782302776394514432 |
---|---|
author | Ash, Susan Campbell, Katrina L. Bogard, Jessica Millichamp, Anna |
author_facet | Ash, Susan Campbell, Katrina L. Bogard, Jessica Millichamp, Anna |
author_sort | Ash, Susan |
collection | PubMed |
description | In Chronic Kidney Disease (CKD), management of diet is important in prevention of disease progression and symptom management, however evidence on nutrition prescription is limited. Recent international CKD guidelines and literature was reviewed to address the following question “What is the appropriate nutrition prescription to achieve positive outcomes in adult patients with chronic kidney disease?” Databases included in the search were Medline and CINAHL using EBSCOhost search engine, Embase and the Cochrane Database of Systematic Reviews published from 2000 to 2009. International guidelines pertaining to nutrition prescription in CKD were also reviewed from 2000 to 2013. Three hundred and eleven papers and eight guidelines were reviewed by three reviewers. Evidence was graded as per the National Health and Medical Research Council of Australia criteria. The evidence from thirty six papers was tabulated under the following headings: protein, weight loss, enteral support, vitamin D, sodium, fat, fibre, oral nutrition supplements, nutrition counselling, including protein and phosphate, nutrients in peritoneal dialysis solution and intradialytic parenteral nutrition, and was compared to international guidelines. While more evidence based studies are warranted, the customary nutrition prescription remains satisfactory with the exception of Vitamin D and phosphate. In these two areas, additional research is urgently needed given the potential of adverse outcomes for the CKD patient. |
format | Online Article Text |
id | pubmed-3916870 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-39168702014-02-07 Nutrition Prescription to Achieve Positive Outcomes in Chronic Kidney Disease: A Systematic Review Ash, Susan Campbell, Katrina L. Bogard, Jessica Millichamp, Anna Nutrients Review In Chronic Kidney Disease (CKD), management of diet is important in prevention of disease progression and symptom management, however evidence on nutrition prescription is limited. Recent international CKD guidelines and literature was reviewed to address the following question “What is the appropriate nutrition prescription to achieve positive outcomes in adult patients with chronic kidney disease?” Databases included in the search were Medline and CINAHL using EBSCOhost search engine, Embase and the Cochrane Database of Systematic Reviews published from 2000 to 2009. International guidelines pertaining to nutrition prescription in CKD were also reviewed from 2000 to 2013. Three hundred and eleven papers and eight guidelines were reviewed by three reviewers. Evidence was graded as per the National Health and Medical Research Council of Australia criteria. The evidence from thirty six papers was tabulated under the following headings: protein, weight loss, enteral support, vitamin D, sodium, fat, fibre, oral nutrition supplements, nutrition counselling, including protein and phosphate, nutrients in peritoneal dialysis solution and intradialytic parenteral nutrition, and was compared to international guidelines. While more evidence based studies are warranted, the customary nutrition prescription remains satisfactory with the exception of Vitamin D and phosphate. In these two areas, additional research is urgently needed given the potential of adverse outcomes for the CKD patient. MDPI 2014-01-22 /pmc/articles/PMC3916870/ /pubmed/24451311 http://dx.doi.org/10.3390/nu6010416 Text en © 2014 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Review Ash, Susan Campbell, Katrina L. Bogard, Jessica Millichamp, Anna Nutrition Prescription to Achieve Positive Outcomes in Chronic Kidney Disease: A Systematic Review |
title | Nutrition Prescription to Achieve Positive Outcomes in Chronic Kidney Disease: A Systematic Review |
title_full | Nutrition Prescription to Achieve Positive Outcomes in Chronic Kidney Disease: A Systematic Review |
title_fullStr | Nutrition Prescription to Achieve Positive Outcomes in Chronic Kidney Disease: A Systematic Review |
title_full_unstemmed | Nutrition Prescription to Achieve Positive Outcomes in Chronic Kidney Disease: A Systematic Review |
title_short | Nutrition Prescription to Achieve Positive Outcomes in Chronic Kidney Disease: A Systematic Review |
title_sort | nutrition prescription to achieve positive outcomes in chronic kidney disease: a systematic review |
topic | Review |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3916870/ https://www.ncbi.nlm.nih.gov/pubmed/24451311 http://dx.doi.org/10.3390/nu6010416 |
work_keys_str_mv | AT ashsusan nutritionprescriptiontoachievepositiveoutcomesinchronickidneydiseaseasystematicreview AT campbellkatrinal nutritionprescriptiontoachievepositiveoutcomesinchronickidneydiseaseasystematicreview AT bogardjessica nutritionprescriptiontoachievepositiveoutcomesinchronickidneydiseaseasystematicreview AT millichampanna nutritionprescriptiontoachievepositiveoutcomesinchronickidneydiseaseasystematicreview |