Cargando…
A New Diagnostic Way for Behcet's Disease: Skin Prick with Self-Saliva
Behcet's disease (BD) is a mysterious multisystemic disorder characterized by recurrent involvement of mucocutaneous (including recurrent aphthous stomatitis; RAS), ocular, intestinal, vascular, and/or nervous system organs. Previously, the positivity of “pathergy test”, which is one of the dia...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Hindawi Publishing Corporation
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3920895/ https://www.ncbi.nlm.nih.gov/pubmed/24587910 http://dx.doi.org/10.1155/2014/581468 |
_version_ | 1782303239262175232 |
---|---|
author | Kaneko, Fumio Togashi, Ari Nomura, Erika Nakamura, Koichiro |
author_facet | Kaneko, Fumio Togashi, Ari Nomura, Erika Nakamura, Koichiro |
author_sort | Kaneko, Fumio |
collection | PubMed |
description | Behcet's disease (BD) is a mysterious multisystemic disorder characterized by recurrent involvement of mucocutaneous (including recurrent aphthous stomatitis; RAS), ocular, intestinal, vascular, and/or nervous system organs. Previously, the positivity of “pathergy test”, which is one of the diagnostic examinations, was reported to be related to the possession of HLA-B51 gene in BD patients, even though the positivity is low and different from the countries. Here, instead of the ordinal pathergy test, we would like to propose the prick with self-saliva as a new diagnostic way for patients with RAS of BD based on the genetic intrinsic factors including HLA-B51 and extrinsic triggering factors. BD patients are considered to acquire the hypersensitivity against oral streptococci through the innate immune mechanism in the oral cavity. Bes-1 gene and 65 kD of heat shock protein (HSP-65) derived from oral S. sanguinis are supposed to play important roles as extrinsic factors in BD pathogenesis. Although the prick positivity was not related to the possession of HLA-B51 gene, the method is suggested to be a significant way for BD diagnosis. The results also suggest that BD symptoms are due to the vascular immune responses by monocytes expressed oral streptococcal agents of the patients. |
format | Online Article Text |
id | pubmed-3920895 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | Hindawi Publishing Corporation |
record_format | MEDLINE/PubMed |
spelling | pubmed-39208952014-03-02 A New Diagnostic Way for Behcet's Disease: Skin Prick with Self-Saliva Kaneko, Fumio Togashi, Ari Nomura, Erika Nakamura, Koichiro Genet Res Int Review Article Behcet's disease (BD) is a mysterious multisystemic disorder characterized by recurrent involvement of mucocutaneous (including recurrent aphthous stomatitis; RAS), ocular, intestinal, vascular, and/or nervous system organs. Previously, the positivity of “pathergy test”, which is one of the diagnostic examinations, was reported to be related to the possession of HLA-B51 gene in BD patients, even though the positivity is low and different from the countries. Here, instead of the ordinal pathergy test, we would like to propose the prick with self-saliva as a new diagnostic way for patients with RAS of BD based on the genetic intrinsic factors including HLA-B51 and extrinsic triggering factors. BD patients are considered to acquire the hypersensitivity against oral streptococci through the innate immune mechanism in the oral cavity. Bes-1 gene and 65 kD of heat shock protein (HSP-65) derived from oral S. sanguinis are supposed to play important roles as extrinsic factors in BD pathogenesis. Although the prick positivity was not related to the possession of HLA-B51 gene, the method is suggested to be a significant way for BD diagnosis. The results also suggest that BD symptoms are due to the vascular immune responses by monocytes expressed oral streptococcal agents of the patients. Hindawi Publishing Corporation 2014 2014-01-23 /pmc/articles/PMC3920895/ /pubmed/24587910 http://dx.doi.org/10.1155/2014/581468 Text en Copyright © 2014 Fumio Kaneko et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Review Article Kaneko, Fumio Togashi, Ari Nomura, Erika Nakamura, Koichiro A New Diagnostic Way for Behcet's Disease: Skin Prick with Self-Saliva |
title | A New Diagnostic Way for Behcet's Disease: Skin Prick with Self-Saliva |
title_full | A New Diagnostic Way for Behcet's Disease: Skin Prick with Self-Saliva |
title_fullStr | A New Diagnostic Way for Behcet's Disease: Skin Prick with Self-Saliva |
title_full_unstemmed | A New Diagnostic Way for Behcet's Disease: Skin Prick with Self-Saliva |
title_short | A New Diagnostic Way for Behcet's Disease: Skin Prick with Self-Saliva |
title_sort | new diagnostic way for behcet's disease: skin prick with self-saliva |
topic | Review Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3920895/ https://www.ncbi.nlm.nih.gov/pubmed/24587910 http://dx.doi.org/10.1155/2014/581468 |
work_keys_str_mv | AT kanekofumio anewdiagnosticwayforbehcetsdiseaseskinprickwithselfsaliva AT togashiari anewdiagnosticwayforbehcetsdiseaseskinprickwithselfsaliva AT nomuraerika anewdiagnosticwayforbehcetsdiseaseskinprickwithselfsaliva AT nakamurakoichiro anewdiagnosticwayforbehcetsdiseaseskinprickwithselfsaliva AT kanekofumio newdiagnosticwayforbehcetsdiseaseskinprickwithselfsaliva AT togashiari newdiagnosticwayforbehcetsdiseaseskinprickwithselfsaliva AT nomuraerika newdiagnosticwayforbehcetsdiseaseskinprickwithselfsaliva AT nakamurakoichiro newdiagnosticwayforbehcetsdiseaseskinprickwithselfsaliva |