BMC Emergency Medicine reviewer acknowledgement, 2013

CONTRIBUTING REVIEWERS: The editors of BMC Emergency Medicine would like to thank all our reviewers who have contributed to the journal in Volume 13 (2013).

Detalles Bibliográficos
Autor principal: Cornacchia, Catia
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Reviewer Acknowledgement
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3922280/
http://dx.doi.org/10.1186/1471-227X-14-4
_version_ 1782303430720618496
author Cornacchia, Catia
author_facet Cornacchia, Catia
author_sort Cornacchia, Catia
collection PubMed
description CONTRIBUTING REVIEWERS: The editors of BMC Emergency Medicine would like to thank all our reviewers who have contributed to the journal in Volume 13 (2013).
format Online
Article
Text
id pubmed-3922280
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-39222802014-02-13 BMC Emergency Medicine reviewer acknowledgement, 2013 Cornacchia, Catia BMC Emerg Med Reviewer Acknowledgement CONTRIBUTING REVIEWERS: The editors of BMC Emergency Medicine would like to thank all our reviewers who have contributed to the journal in Volume 13 (2013). BioMed Central 2014-02-13 /pmc/articles/PMC3922280/ http://dx.doi.org/10.1186/1471-227X-14-4 Text en Copyright © 2014 Cornacchia; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Reviewer Acknowledgement
Cornacchia, Catia
BMC Emergency Medicine reviewer acknowledgement, 2013
title BMC Emergency Medicine reviewer acknowledgement, 2013
title_full BMC Emergency Medicine reviewer acknowledgement, 2013
title_fullStr BMC Emergency Medicine reviewer acknowledgement, 2013
title_full_unstemmed BMC Emergency Medicine reviewer acknowledgement, 2013
title_short BMC Emergency Medicine reviewer acknowledgement, 2013
title_sort bmc emergency medicine reviewer acknowledgement, 2013
topic Reviewer Acknowledgement
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3922280/
http://dx.doi.org/10.1186/1471-227X-14-4
work_keys_str_mv AT cornacchiacatia bmcemergencymedicinerevieweracknowledgement2013

Ejemplares similares