Cargando…
Copy number variations of the extensively amplified Y-linked genes, HSFY and ZNF280BY, in cattle and their association with male reproductive traits in Holstein bulls
BACKGROUND: Recent transcriptomic analysis of the bovine Y chromosome revealed at least six multi-copy protein coding gene families, including TSPY, HSFY and ZNF280BY, on the male-specific region (MSY). Previous studies indicated that the copy number variations (CNVs) of the human and bovine TSPY we...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3924399/ https://www.ncbi.nlm.nih.gov/pubmed/24507556 http://dx.doi.org/10.1186/1471-2164-15-113 |
_version_ | 1782303738529054720 |
---|---|
author | Yue, Xiang-Peng Dechow, Chad Chang, Ti-Cheng DeJarnette, James Melton Marshall, Clifton Eugene Lei, Chu-Zhao Liu, Wan-Sheng |
author_facet | Yue, Xiang-Peng Dechow, Chad Chang, Ti-Cheng DeJarnette, James Melton Marshall, Clifton Eugene Lei, Chu-Zhao Liu, Wan-Sheng |
author_sort | Yue, Xiang-Peng |
collection | PubMed |
description | BACKGROUND: Recent transcriptomic analysis of the bovine Y chromosome revealed at least six multi-copy protein coding gene families, including TSPY, HSFY and ZNF280BY, on the male-specific region (MSY). Previous studies indicated that the copy number variations (CNVs) of the human and bovine TSPY were associated with male fertility in men and cattle. However, the relationship between CNVs of the bovine Y-linked HSFY and ZNF280BY gene families and bull fertility has not been investigated. RESULTS: We investigated the copy number (CN) of the bovine HSFY and ZNF280BY in a total of 460 bulls from 15 breeds using a quantitative PCR approach. We observed CNVs for both gene families within and between cattle breeds. The median copy number (MCN) of HSFY among all bulls was 197, ranging from 21 to 308. The MCN of ZNF280BY was 236, varying from 28 to 380. Furthermore, bulls in the Bos taurus (BTA) lineage had a significantly higher MCN (202) of HSFY than bulls in the Bos indicus (BIN) lineage (178), while taurine bulls had a significantly lower MCN (231) of ZNF280BY than indicine bulls (284). In addition, the CN of ZNF280BY was positively correlated to that of HSFY on the BTAY. Association analysis revealed that the CNVs of both HSFY and ZNF280BY were correlated negatively with testis size, while positively with sire conception rate. CONCLUSION: The bovine HSFY and ZNF280BY gene families have extensively expanded on the Y chromosome during evolution. The CN of both gene families varies significantly among individuals and cattle breeds. These variations were associated with testis size and bull fertility in Holstein, suggesting that the CNVs of HSFY and ZNF280BY may serve as valuable makers for male fertility selection in cattle. |
format | Online Article Text |
id | pubmed-3924399 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-39243992014-02-15 Copy number variations of the extensively amplified Y-linked genes, HSFY and ZNF280BY, in cattle and their association with male reproductive traits in Holstein bulls Yue, Xiang-Peng Dechow, Chad Chang, Ti-Cheng DeJarnette, James Melton Marshall, Clifton Eugene Lei, Chu-Zhao Liu, Wan-Sheng BMC Genomics Research Article BACKGROUND: Recent transcriptomic analysis of the bovine Y chromosome revealed at least six multi-copy protein coding gene families, including TSPY, HSFY and ZNF280BY, on the male-specific region (MSY). Previous studies indicated that the copy number variations (CNVs) of the human and bovine TSPY were associated with male fertility in men and cattle. However, the relationship between CNVs of the bovine Y-linked HSFY and ZNF280BY gene families and bull fertility has not been investigated. RESULTS: We investigated the copy number (CN) of the bovine HSFY and ZNF280BY in a total of 460 bulls from 15 breeds using a quantitative PCR approach. We observed CNVs for both gene families within and between cattle breeds. The median copy number (MCN) of HSFY among all bulls was 197, ranging from 21 to 308. The MCN of ZNF280BY was 236, varying from 28 to 380. Furthermore, bulls in the Bos taurus (BTA) lineage had a significantly higher MCN (202) of HSFY than bulls in the Bos indicus (BIN) lineage (178), while taurine bulls had a significantly lower MCN (231) of ZNF280BY than indicine bulls (284). In addition, the CN of ZNF280BY was positively correlated to that of HSFY on the BTAY. Association analysis revealed that the CNVs of both HSFY and ZNF280BY were correlated negatively with testis size, while positively with sire conception rate. CONCLUSION: The bovine HSFY and ZNF280BY gene families have extensively expanded on the Y chromosome during evolution. The CN of both gene families varies significantly among individuals and cattle breeds. These variations were associated with testis size and bull fertility in Holstein, suggesting that the CNVs of HSFY and ZNF280BY may serve as valuable makers for male fertility selection in cattle. BioMed Central 2014-02-08 /pmc/articles/PMC3924399/ /pubmed/24507556 http://dx.doi.org/10.1186/1471-2164-15-113 Text en Copyright © 2014 Yue et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an open access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Research Article Yue, Xiang-Peng Dechow, Chad Chang, Ti-Cheng DeJarnette, James Melton Marshall, Clifton Eugene Lei, Chu-Zhao Liu, Wan-Sheng Copy number variations of the extensively amplified Y-linked genes, HSFY and ZNF280BY, in cattle and their association with male reproductive traits in Holstein bulls |
title | Copy number variations of the extensively amplified Y-linked genes, HSFY and ZNF280BY, in cattle and their association with male reproductive traits in Holstein bulls |
title_full | Copy number variations of the extensively amplified Y-linked genes, HSFY and ZNF280BY, in cattle and their association with male reproductive traits in Holstein bulls |
title_fullStr | Copy number variations of the extensively amplified Y-linked genes, HSFY and ZNF280BY, in cattle and their association with male reproductive traits in Holstein bulls |
title_full_unstemmed | Copy number variations of the extensively amplified Y-linked genes, HSFY and ZNF280BY, in cattle and their association with male reproductive traits in Holstein bulls |
title_short | Copy number variations of the extensively amplified Y-linked genes, HSFY and ZNF280BY, in cattle and their association with male reproductive traits in Holstein bulls |
title_sort | copy number variations of the extensively amplified y-linked genes, hsfy and znf280by, in cattle and their association with male reproductive traits in holstein bulls |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3924399/ https://www.ncbi.nlm.nih.gov/pubmed/24507556 http://dx.doi.org/10.1186/1471-2164-15-113 |
work_keys_str_mv | AT yuexiangpeng copynumbervariationsoftheextensivelyamplifiedylinkedgeneshsfyandznf280byincattleandtheirassociationwithmalereproductivetraitsinholsteinbulls AT dechowchad copynumbervariationsoftheextensivelyamplifiedylinkedgeneshsfyandznf280byincattleandtheirassociationwithmalereproductivetraitsinholsteinbulls AT changticheng copynumbervariationsoftheextensivelyamplifiedylinkedgeneshsfyandznf280byincattleandtheirassociationwithmalereproductivetraitsinholsteinbulls AT dejarnettejamesmelton copynumbervariationsoftheextensivelyamplifiedylinkedgeneshsfyandznf280byincattleandtheirassociationwithmalereproductivetraitsinholsteinbulls AT marshallcliftoneugene copynumbervariationsoftheextensivelyamplifiedylinkedgeneshsfyandznf280byincattleandtheirassociationwithmalereproductivetraitsinholsteinbulls AT leichuzhao copynumbervariationsoftheextensivelyamplifiedylinkedgeneshsfyandznf280byincattleandtheirassociationwithmalereproductivetraitsinholsteinbulls AT liuwansheng copynumbervariationsoftheextensivelyamplifiedylinkedgeneshsfyandznf280byincattleandtheirassociationwithmalereproductivetraitsinholsteinbulls |