Cargando…

Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae)

We investigate the synergistic stimulation by K(+) plus NH(4) (+) of (Na(+), K(+))-ATPase activity in microsomal preparations of whole zoea I and decapodid III, and in juvenile and adult river shrimp gills. Modulation of (Na(+), K(+))-ATPase activity is ontogenetic stage-specific, and particularly d...

Descripción completa

Detalles Bibliográficos
Autores principales: Leone, Francisco A., Bezerra, Thais M. S., Garçon, Daniela P., Lucena, Malson N., Pinto, Marcelo R., Fontes, Carlos F. L., McNamara, John C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3931822/
https://www.ncbi.nlm.nih.gov/pubmed/24586919
http://dx.doi.org/10.1371/journal.pone.0089625
_version_ 1782304720486924288
author Leone, Francisco A.
Bezerra, Thais M. S.
Garçon, Daniela P.
Lucena, Malson N.
Pinto, Marcelo R.
Fontes, Carlos F. L.
McNamara, John C.
author_facet Leone, Francisco A.
Bezerra, Thais M. S.
Garçon, Daniela P.
Lucena, Malson N.
Pinto, Marcelo R.
Fontes, Carlos F. L.
McNamara, John C.
author_sort Leone, Francisco A.
collection PubMed
description We investigate the synergistic stimulation by K(+) plus NH(4) (+) of (Na(+), K(+))-ATPase activity in microsomal preparations of whole zoea I and decapodid III, and in juvenile and adult river shrimp gills. Modulation of (Na(+), K(+))-ATPase activity is ontogenetic stage-specific, and particularly distinct between juveniles and adults. Although both gill enzymes exhibit two different sites for K(+) and NH(4) (+) binding, in the juvenile enzyme, these two sites are equivalent: binding by both ions results in slightly stimulated activity compared to that of a single ionic species. In the adult enzyme, the sites are not equivalent: when one ion occupies its specific binding site, (Na(+), K(+))-ATPase activity is stimulated synergistically by ≈50% on binding of the complementary ion. Immunolocalization reveals the enzyme to be distributed predominantly throughout the intralamellar septum in the gill lamellae of juveniles and adults. Western blot analyses demonstrate a single immunoreactive band, suggesting a single (Na(+), K(+))-ATPase α-subunit isoform that is distributed into different density membrane fractions, independently of ontogenetic stage. We propose a model for the modulation by K(+) and NH(4) (+) of gill (Na(+), K(+))-ATPase activity. These findings suggest that the gill enzyme may be regulated by NH(4) (+) during ontogenetic development in M. amazonicum.
format Online
Article
Text
id pubmed-3931822
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-39318222014-02-25 Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae) Leone, Francisco A. Bezerra, Thais M. S. Garçon, Daniela P. Lucena, Malson N. Pinto, Marcelo R. Fontes, Carlos F. L. McNamara, John C. PLoS One Research Article We investigate the synergistic stimulation by K(+) plus NH(4) (+) of (Na(+), K(+))-ATPase activity in microsomal preparations of whole zoea I and decapodid III, and in juvenile and adult river shrimp gills. Modulation of (Na(+), K(+))-ATPase activity is ontogenetic stage-specific, and particularly distinct between juveniles and adults. Although both gill enzymes exhibit two different sites for K(+) and NH(4) (+) binding, in the juvenile enzyme, these two sites are equivalent: binding by both ions results in slightly stimulated activity compared to that of a single ionic species. In the adult enzyme, the sites are not equivalent: when one ion occupies its specific binding site, (Na(+), K(+))-ATPase activity is stimulated synergistically by ≈50% on binding of the complementary ion. Immunolocalization reveals the enzyme to be distributed predominantly throughout the intralamellar septum in the gill lamellae of juveniles and adults. Western blot analyses demonstrate a single immunoreactive band, suggesting a single (Na(+), K(+))-ATPase α-subunit isoform that is distributed into different density membrane fractions, independently of ontogenetic stage. We propose a model for the modulation by K(+) and NH(4) (+) of gill (Na(+), K(+))-ATPase activity. These findings suggest that the gill enzyme may be regulated by NH(4) (+) during ontogenetic development in M. amazonicum. Public Library of Science 2014-02-21 /pmc/articles/PMC3931822/ /pubmed/24586919 http://dx.doi.org/10.1371/journal.pone.0089625 Text en © 2014 Leone et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Leone, Francisco A.
Bezerra, Thais M. S.
Garçon, Daniela P.
Lucena, Malson N.
Pinto, Marcelo R.
Fontes, Carlos F. L.
McNamara, John C.
Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae)
title Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae)
title_full Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae)
title_fullStr Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae)
title_full_unstemmed Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae)
title_short Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae)
title_sort modulation by k(+) plus nh(4) (+) of microsomal (na(+), k(+))-atpase activity in selected ontogenetic stages of the diadromous river shrimp macrobrachium amazonicum (decapoda, palaemonidae)
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3931822/
https://www.ncbi.nlm.nih.gov/pubmed/24586919
http://dx.doi.org/10.1371/journal.pone.0089625
work_keys_str_mv AT leonefranciscoa modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae
AT bezerrathaisms modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae
AT garcondanielap modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae
AT lucenamalsonn modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae
AT pintomarcelor modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae
AT fontescarlosfl modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae
AT mcnamarajohnc modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae