Cargando…
Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae)
We investigate the synergistic stimulation by K(+) plus NH(4) (+) of (Na(+), K(+))-ATPase activity in microsomal preparations of whole zoea I and decapodid III, and in juvenile and adult river shrimp gills. Modulation of (Na(+), K(+))-ATPase activity is ontogenetic stage-specific, and particularly d...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3931822/ https://www.ncbi.nlm.nih.gov/pubmed/24586919 http://dx.doi.org/10.1371/journal.pone.0089625 |
_version_ | 1782304720486924288 |
---|---|
author | Leone, Francisco A. Bezerra, Thais M. S. Garçon, Daniela P. Lucena, Malson N. Pinto, Marcelo R. Fontes, Carlos F. L. McNamara, John C. |
author_facet | Leone, Francisco A. Bezerra, Thais M. S. Garçon, Daniela P. Lucena, Malson N. Pinto, Marcelo R. Fontes, Carlos F. L. McNamara, John C. |
author_sort | Leone, Francisco A. |
collection | PubMed |
description | We investigate the synergistic stimulation by K(+) plus NH(4) (+) of (Na(+), K(+))-ATPase activity in microsomal preparations of whole zoea I and decapodid III, and in juvenile and adult river shrimp gills. Modulation of (Na(+), K(+))-ATPase activity is ontogenetic stage-specific, and particularly distinct between juveniles and adults. Although both gill enzymes exhibit two different sites for K(+) and NH(4) (+) binding, in the juvenile enzyme, these two sites are equivalent: binding by both ions results in slightly stimulated activity compared to that of a single ionic species. In the adult enzyme, the sites are not equivalent: when one ion occupies its specific binding site, (Na(+), K(+))-ATPase activity is stimulated synergistically by ≈50% on binding of the complementary ion. Immunolocalization reveals the enzyme to be distributed predominantly throughout the intralamellar septum in the gill lamellae of juveniles and adults. Western blot analyses demonstrate a single immunoreactive band, suggesting a single (Na(+), K(+))-ATPase α-subunit isoform that is distributed into different density membrane fractions, independently of ontogenetic stage. We propose a model for the modulation by K(+) and NH(4) (+) of gill (Na(+), K(+))-ATPase activity. These findings suggest that the gill enzyme may be regulated by NH(4) (+) during ontogenetic development in M. amazonicum. |
format | Online Article Text |
id | pubmed-3931822 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-39318222014-02-25 Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae) Leone, Francisco A. Bezerra, Thais M. S. Garçon, Daniela P. Lucena, Malson N. Pinto, Marcelo R. Fontes, Carlos F. L. McNamara, John C. PLoS One Research Article We investigate the synergistic stimulation by K(+) plus NH(4) (+) of (Na(+), K(+))-ATPase activity in microsomal preparations of whole zoea I and decapodid III, and in juvenile and adult river shrimp gills. Modulation of (Na(+), K(+))-ATPase activity is ontogenetic stage-specific, and particularly distinct between juveniles and adults. Although both gill enzymes exhibit two different sites for K(+) and NH(4) (+) binding, in the juvenile enzyme, these two sites are equivalent: binding by both ions results in slightly stimulated activity compared to that of a single ionic species. In the adult enzyme, the sites are not equivalent: when one ion occupies its specific binding site, (Na(+), K(+))-ATPase activity is stimulated synergistically by ≈50% on binding of the complementary ion. Immunolocalization reveals the enzyme to be distributed predominantly throughout the intralamellar septum in the gill lamellae of juveniles and adults. Western blot analyses demonstrate a single immunoreactive band, suggesting a single (Na(+), K(+))-ATPase α-subunit isoform that is distributed into different density membrane fractions, independently of ontogenetic stage. We propose a model for the modulation by K(+) and NH(4) (+) of gill (Na(+), K(+))-ATPase activity. These findings suggest that the gill enzyme may be regulated by NH(4) (+) during ontogenetic development in M. amazonicum. Public Library of Science 2014-02-21 /pmc/articles/PMC3931822/ /pubmed/24586919 http://dx.doi.org/10.1371/journal.pone.0089625 Text en © 2014 Leone et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Leone, Francisco A. Bezerra, Thais M. S. Garçon, Daniela P. Lucena, Malson N. Pinto, Marcelo R. Fontes, Carlos F. L. McNamara, John C. Modulation By K(+) Plus NH(4) (+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae) |
title | Modulation By K(+) Plus NH(4)
(+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae) |
title_full | Modulation By K(+) Plus NH(4)
(+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae) |
title_fullStr | Modulation By K(+) Plus NH(4)
(+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae) |
title_full_unstemmed | Modulation By K(+) Plus NH(4)
(+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae) |
title_short | Modulation By K(+) Plus NH(4)
(+) of Microsomal (Na(+), K(+))-ATPase Activity in Selected Ontogenetic Stages of the Diadromous River Shrimp Macrobrachium amazonicum (Decapoda, Palaemonidae) |
title_sort | modulation by k(+) plus nh(4)
(+) of microsomal (na(+), k(+))-atpase activity in selected ontogenetic stages of the diadromous river shrimp macrobrachium amazonicum (decapoda, palaemonidae) |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3931822/ https://www.ncbi.nlm.nih.gov/pubmed/24586919 http://dx.doi.org/10.1371/journal.pone.0089625 |
work_keys_str_mv | AT leonefranciscoa modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae AT bezerrathaisms modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae AT garcondanielap modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae AT lucenamalsonn modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae AT pintomarcelor modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae AT fontescarlosfl modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae AT mcnamarajohnc modulationbykplusnh4ofmicrosomalnakatpaseactivityinselectedontogeneticstagesofthediadromousrivershrimpmacrobrachiumamazonicumdecapodapalaemonidae |