Cargando…

PAK4 confers cisplatin resistance in gastric cancer cells via PI3K/Akt- and MEK/ERK-dependent pathways

CDDP [cisplatin or cis-diamminedichloroplatinum(II)] and CDDP-based combination chemotherapy have been confirmed effective against gastric cancer. However, CDDP efficiency is limited because of development of drug resistance. In this study, we found that PAK4 (p21-activated kinase 4) expression and...

Descripción completa

Detalles Bibliográficos
Autores principales: Fu, Xueqiong, Feng, Jiarui, Zeng, Duan, Ding, Yu, Yu, Changshou, Yang, Bing
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Portland Press Ltd. 2014
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3941610/
https://www.ncbi.nlm.nih.gov/pubmed/27919028
http://dx.doi.org/10.1042/BSR20130102
_version_ 1782305956262051840
author Fu, Xueqiong
Feng, Jiarui
Zeng, Duan
Ding, Yu
Yu, Changshou
Yang, Bing
author_facet Fu, Xueqiong
Feng, Jiarui
Zeng, Duan
Ding, Yu
Yu, Changshou
Yang, Bing
author_sort Fu, Xueqiong
collection PubMed
description CDDP [cisplatin or cis-diamminedichloroplatinum(II)] and CDDP-based combination chemotherapy have been confirmed effective against gastric cancer. However, CDDP efficiency is limited because of development of drug resistance. In this study, we found that PAK4 (p21-activated kinase 4) expression and activity were elevated in gastric cancer cells with acquired CDDP resistance (AGS/CDDP and MKN-45/CDDP) compared with their parental cells. Inhibition of PAK4 or knockdown of PAK4 expression by specific siRNA (small interfering RNA)-sensitized CDDP-resistant cells to CDDP and overcome CDDP resistance. Combination treatment of LY294002 [the inhibitor of PI3K (phosphoinositide 3-kinase)/Akt (protein kinase B or PKB) pathway] or PD98509 {the inhibitor of MEK [MAPK (mitogen-activated protein kinase)/ERK (extracellular-signal-regulated kinase) kinase] pathway} with PF-3758309 (the PAK4 inhibitor) resulted in increased CDDP efficacy compared with LY294002 or PD98509 alone. However, after the concomitant treatment of LY294002 and PD98509, PF-3758309 administration exerted no additional enhancement of CDDP cytotoxicity in CDDP-resistant cells. Inhibition of PAK4 by PF-3758309 could significantly suppress MEK/ERK and PI3K/Akt signalling in CDDP-resistant cells. Furthermore, inhibition of PI3K/Akt pathway while not MEK/ERK pathway could inhibit PAK4 activity in these cells. The in vivo results were similar with those of in vitro. In conclusion, these results indicate that PAK4 confers CDDP resistance via the activation of MEK/ERK and PI3K/Akt pathways. PAK4 and PI3K/Akt pathways can reciprocally activate each other. Therefore, PAK4 may be a potential target for overcoming CDDP resistance in gastric cancer.
format Online
Article
Text
id pubmed-3941610
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Portland Press Ltd.
record_format MEDLINE/PubMed
spelling pubmed-39416102014-03-05 PAK4 confers cisplatin resistance in gastric cancer cells via PI3K/Akt- and MEK/ERK-dependent pathways Fu, Xueqiong Feng, Jiarui Zeng, Duan Ding, Yu Yu, Changshou Yang, Bing Biosci Rep CDDP [cisplatin or cis-diamminedichloroplatinum(II)] and CDDP-based combination chemotherapy have been confirmed effective against gastric cancer. However, CDDP efficiency is limited because of development of drug resistance. In this study, we found that PAK4 (p21-activated kinase 4) expression and activity were elevated in gastric cancer cells with acquired CDDP resistance (AGS/CDDP and MKN-45/CDDP) compared with their parental cells. Inhibition of PAK4 or knockdown of PAK4 expression by specific siRNA (small interfering RNA)-sensitized CDDP-resistant cells to CDDP and overcome CDDP resistance. Combination treatment of LY294002 [the inhibitor of PI3K (phosphoinositide 3-kinase)/Akt (protein kinase B or PKB) pathway] or PD98509 {the inhibitor of MEK [MAPK (mitogen-activated protein kinase)/ERK (extracellular-signal-regulated kinase) kinase] pathway} with PF-3758309 (the PAK4 inhibitor) resulted in increased CDDP efficacy compared with LY294002 or PD98509 alone. However, after the concomitant treatment of LY294002 and PD98509, PF-3758309 administration exerted no additional enhancement of CDDP cytotoxicity in CDDP-resistant cells. Inhibition of PAK4 by PF-3758309 could significantly suppress MEK/ERK and PI3K/Akt signalling in CDDP-resistant cells. Furthermore, inhibition of PI3K/Akt pathway while not MEK/ERK pathway could inhibit PAK4 activity in these cells. The in vivo results were similar with those of in vitro. In conclusion, these results indicate that PAK4 confers CDDP resistance via the activation of MEK/ERK and PI3K/Akt pathways. PAK4 and PI3K/Akt pathways can reciprocally activate each other. Therefore, PAK4 may be a potential target for overcoming CDDP resistance in gastric cancer. Portland Press Ltd. 2014-03-04 /pmc/articles/PMC3941610/ /pubmed/27919028 http://dx.doi.org/10.1042/BSR20130102 Text en © 2014 The author(s) has paid for this article to be freely available under the terms of the Creative Commons Attribution Licence (CC-BY)(http://creativecommons.org/licenses/by/3.0/) which permits unrestricted use, distribution and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/licenses/by/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Licence (CC-BY) (http://creativecommons.org/licenses/by/3.0/) which permits unrestricted use, distribution and reproduction in any medium, provided the original work is properly cited.
spellingShingle Fu, Xueqiong
Feng, Jiarui
Zeng, Duan
Ding, Yu
Yu, Changshou
Yang, Bing
PAK4 confers cisplatin resistance in gastric cancer cells via PI3K/Akt- and MEK/ERK-dependent pathways
title PAK4 confers cisplatin resistance in gastric cancer cells via PI3K/Akt- and MEK/ERK-dependent pathways
title_full PAK4 confers cisplatin resistance in gastric cancer cells via PI3K/Akt- and MEK/ERK-dependent pathways
title_fullStr PAK4 confers cisplatin resistance in gastric cancer cells via PI3K/Akt- and MEK/ERK-dependent pathways
title_full_unstemmed PAK4 confers cisplatin resistance in gastric cancer cells via PI3K/Akt- and MEK/ERK-dependent pathways
title_short PAK4 confers cisplatin resistance in gastric cancer cells via PI3K/Akt- and MEK/ERK-dependent pathways
title_sort pak4 confers cisplatin resistance in gastric cancer cells via pi3k/akt- and mek/erk-dependent pathways
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3941610/
https://www.ncbi.nlm.nih.gov/pubmed/27919028
http://dx.doi.org/10.1042/BSR20130102
work_keys_str_mv AT fuxueqiong pak4conferscisplatinresistanceingastriccancercellsviapi3kaktandmekerkdependentpathways
AT fengjiarui pak4conferscisplatinresistanceingastriccancercellsviapi3kaktandmekerkdependentpathways
AT zengduan pak4conferscisplatinresistanceingastriccancercellsviapi3kaktandmekerkdependentpathways
AT dingyu pak4conferscisplatinresistanceingastriccancercellsviapi3kaktandmekerkdependentpathways
AT yuchangshou pak4conferscisplatinresistanceingastriccancercellsviapi3kaktandmekerkdependentpathways
AT yangbing pak4conferscisplatinresistanceingastriccancercellsviapi3kaktandmekerkdependentpathways