Cargando…

The Role of Vitamin D Deficiency and Vitamin D Receptor Genotypes on the Degree of Collateralization in Patients with Suspected Coronary Artery Disease

We determined the association of vitamin D deficiency and the FokI polymorphism of the vitamin D receptor (VDR) gene in 760 patients who underwent angiography due to suspected coronary artery disease (CAD). Angiography and the Rentrop scoring system were used to classify the severity of CAD in each...

Descripción completa

Detalles Bibliográficos
Autores principales: Hossein-Nezhad, Arash, Eshaghi, Seyede Mahdieh, Maghbooli, Zhila, Mirzaei, Khadijeh, Shirzad, Mahmood, Curletto, Bryon, Chen, Tai C.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3963370/
https://www.ncbi.nlm.nih.gov/pubmed/24729966
http://dx.doi.org/10.1155/2014/304250
_version_ 1782308503715577856
author Hossein-Nezhad, Arash
Eshaghi, Seyede Mahdieh
Maghbooli, Zhila
Mirzaei, Khadijeh
Shirzad, Mahmood
Curletto, Bryon
Chen, Tai C.
author_facet Hossein-Nezhad, Arash
Eshaghi, Seyede Mahdieh
Maghbooli, Zhila
Mirzaei, Khadijeh
Shirzad, Mahmood
Curletto, Bryon
Chen, Tai C.
author_sort Hossein-Nezhad, Arash
collection PubMed
description We determined the association of vitamin D deficiency and the FokI polymorphism of the vitamin D receptor (VDR) gene in 760 patients who underwent angiography due to suspected coronary artery disease (CAD). Angiography and the Rentrop scoring system were used to classify the severity of CAD in each patient and to grade the extent of collateral development, respectively. Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) was used to determine the FokI VDR gene polymorphism. The prevalence of severe vitamin D deficiency (serum 25(OH)D < 10 ng/mL) was significantly higher in patients with at least one stenotic coronary artery compared to those without any stenotic coronary arteries. Severe vitamin D deficiency was not independently associated with collateralization, but it was significantly associated with the VDR genotypes. In turn, VDR genotype was independently associated with the degree of collateralization; the Rentrop scores were the highest in FF, intermediate in Ff, and the lowest in the ff genotype. The results show that FokI polymorphism is independently associated with collateralization. Additionally, vitamin D deficiency is more prevalent in patients with CAD that may result from FokI polymorphism. Therefore, maintaining a normal vitamin D status should be a high priority for patients with CAD.
format Online
Article
Text
id pubmed-3963370
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-39633702014-04-13 The Role of Vitamin D Deficiency and Vitamin D Receptor Genotypes on the Degree of Collateralization in Patients with Suspected Coronary Artery Disease Hossein-Nezhad, Arash Eshaghi, Seyede Mahdieh Maghbooli, Zhila Mirzaei, Khadijeh Shirzad, Mahmood Curletto, Bryon Chen, Tai C. Biomed Res Int Clinical Study We determined the association of vitamin D deficiency and the FokI polymorphism of the vitamin D receptor (VDR) gene in 760 patients who underwent angiography due to suspected coronary artery disease (CAD). Angiography and the Rentrop scoring system were used to classify the severity of CAD in each patient and to grade the extent of collateral development, respectively. Polymerase chain reaction-restriction fragment length polymorphism (PCR-RFLP) was used to determine the FokI VDR gene polymorphism. The prevalence of severe vitamin D deficiency (serum 25(OH)D < 10 ng/mL) was significantly higher in patients with at least one stenotic coronary artery compared to those without any stenotic coronary arteries. Severe vitamin D deficiency was not independently associated with collateralization, but it was significantly associated with the VDR genotypes. In turn, VDR genotype was independently associated with the degree of collateralization; the Rentrop scores were the highest in FF, intermediate in Ff, and the lowest in the ff genotype. The results show that FokI polymorphism is independently associated with collateralization. Additionally, vitamin D deficiency is more prevalent in patients with CAD that may result from FokI polymorphism. Therefore, maintaining a normal vitamin D status should be a high priority for patients with CAD. Hindawi Publishing Corporation 2014 2014-03-06 /pmc/articles/PMC3963370/ /pubmed/24729966 http://dx.doi.org/10.1155/2014/304250 Text en Copyright © 2014 Arash Hossein-Nezhad et al. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Clinical Study
Hossein-Nezhad, Arash
Eshaghi, Seyede Mahdieh
Maghbooli, Zhila
Mirzaei, Khadijeh
Shirzad, Mahmood
Curletto, Bryon
Chen, Tai C.
The Role of Vitamin D Deficiency and Vitamin D Receptor Genotypes on the Degree of Collateralization in Patients with Suspected Coronary Artery Disease
title The Role of Vitamin D Deficiency and Vitamin D Receptor Genotypes on the Degree of Collateralization in Patients with Suspected Coronary Artery Disease
title_full The Role of Vitamin D Deficiency and Vitamin D Receptor Genotypes on the Degree of Collateralization in Patients with Suspected Coronary Artery Disease
title_fullStr The Role of Vitamin D Deficiency and Vitamin D Receptor Genotypes on the Degree of Collateralization in Patients with Suspected Coronary Artery Disease
title_full_unstemmed The Role of Vitamin D Deficiency and Vitamin D Receptor Genotypes on the Degree of Collateralization in Patients with Suspected Coronary Artery Disease
title_short The Role of Vitamin D Deficiency and Vitamin D Receptor Genotypes on the Degree of Collateralization in Patients with Suspected Coronary Artery Disease
title_sort role of vitamin d deficiency and vitamin d receptor genotypes on the degree of collateralization in patients with suspected coronary artery disease
topic Clinical Study
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3963370/
https://www.ncbi.nlm.nih.gov/pubmed/24729966
http://dx.doi.org/10.1155/2014/304250
work_keys_str_mv AT hosseinnezhadarash theroleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT eshaghiseyedemahdieh theroleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT maghboolizhila theroleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT mirzaeikhadijeh theroleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT shirzadmahmood theroleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT curlettobryon theroleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT chentaic theroleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT hosseinnezhadarash roleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT eshaghiseyedemahdieh roleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT maghboolizhila roleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT mirzaeikhadijeh roleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT shirzadmahmood roleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT curlettobryon roleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease
AT chentaic roleofvitaminddeficiencyandvitamindreceptorgenotypesonthedegreeofcollateralizationinpatientswithsuspectedcoronaryarterydisease