Cargando…
Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study
BACKGROUND: The present study’s aim has been to investigate, identify and interpret the views of pediatric primary healthcare providers on the recognition and management of maternal depression in the context of a weak primary healthcare system. METHODS: Twenty six pediatricians and health visitors w...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3984632/ https://www.ncbi.nlm.nih.gov/pubmed/24725738 http://dx.doi.org/10.1186/1471-244X-14-108 |
_version_ | 1782311459849502720 |
---|---|
author | Agapidaki, Eirini Souliotis, Kyriakos Jackson, Suzanne F Benetou, Vassiliki Christogiorgos, Stylianos Dimitrakaki, Christina Tountas, Yannis |
author_facet | Agapidaki, Eirini Souliotis, Kyriakos Jackson, Suzanne F Benetou, Vassiliki Christogiorgos, Stylianos Dimitrakaki, Christina Tountas, Yannis |
author_sort | Agapidaki, Eirini |
collection | PubMed |
description | BACKGROUND: The present study’s aim has been to investigate, identify and interpret the views of pediatric primary healthcare providers on the recognition and management of maternal depression in the context of a weak primary healthcare system. METHODS: Twenty six pediatricians and health visitors were selected by using purposive sampling. Face to face in-depth interviews of approximately 45 minutes duration were conducted. The data were analyzed by using the framework analysis approach which includes five main steps: familiarization, identifying a thematic framework, indexing, charting, mapping and interpretation. RESULTS: Fear of stigmatization came across as a key barrier for detection and management of maternal depression. Pediatric primary health care providers linked their hesitation to start a conversation about depression with stigma. They highlighted that mothers were not receptive to discussing depression and accepting a referral. It was also revealed that the fragmented primary health care system and the lack of collaboration between health and mental health services have resulted in an unfavorable situation towards maternal mental health. CONCLUSIONS: Even though pediatricians and health visitors are aware about maternal depression and the importance of maternal mental health, however they fail to implement detection and management practices successfully. The inefficiently decentralized psychiatric services but also stigmatization and misconceptions about maternal depression have impeded the integration of maternal mental health into primary care and prevent pediatric primary health care providers from implementing detection and management practices. |
format | Online Article Text |
id | pubmed-3984632 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-39846322014-04-13 Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study Agapidaki, Eirini Souliotis, Kyriakos Jackson, Suzanne F Benetou, Vassiliki Christogiorgos, Stylianos Dimitrakaki, Christina Tountas, Yannis BMC Psychiatry Research Article BACKGROUND: The present study’s aim has been to investigate, identify and interpret the views of pediatric primary healthcare providers on the recognition and management of maternal depression in the context of a weak primary healthcare system. METHODS: Twenty six pediatricians and health visitors were selected by using purposive sampling. Face to face in-depth interviews of approximately 45 minutes duration were conducted. The data were analyzed by using the framework analysis approach which includes five main steps: familiarization, identifying a thematic framework, indexing, charting, mapping and interpretation. RESULTS: Fear of stigmatization came across as a key barrier for detection and management of maternal depression. Pediatric primary health care providers linked their hesitation to start a conversation about depression with stigma. They highlighted that mothers were not receptive to discussing depression and accepting a referral. It was also revealed that the fragmented primary health care system and the lack of collaboration between health and mental health services have resulted in an unfavorable situation towards maternal mental health. CONCLUSIONS: Even though pediatricians and health visitors are aware about maternal depression and the importance of maternal mental health, however they fail to implement detection and management practices successfully. The inefficiently decentralized psychiatric services but also stigmatization and misconceptions about maternal depression have impeded the integration of maternal mental health into primary care and prevent pediatric primary health care providers from implementing detection and management practices. BioMed Central 2014-04-11 /pmc/articles/PMC3984632/ /pubmed/24725738 http://dx.doi.org/10.1186/1471-244X-14-108 Text en Copyright © 2014 Agapidaki et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Article Agapidaki, Eirini Souliotis, Kyriakos Jackson, Suzanne F Benetou, Vassiliki Christogiorgos, Stylianos Dimitrakaki, Christina Tountas, Yannis Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study |
title | Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study |
title_full | Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study |
title_fullStr | Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study |
title_full_unstemmed | Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study |
title_short | Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study |
title_sort | pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3984632/ https://www.ncbi.nlm.nih.gov/pubmed/24725738 http://dx.doi.org/10.1186/1471-244X-14-108 |
work_keys_str_mv | AT agapidakieirini pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy AT souliotiskyriakos pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy AT jacksonsuzannef pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy AT benetouvassiliki pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy AT christogiorgosstylianos pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy AT dimitrakakichristina pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy AT tountasyannis pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy |