Cargando…

Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study

BACKGROUND: The present study’s aim has been to investigate, identify and interpret the views of pediatric primary healthcare providers on the recognition and management of maternal depression in the context of a weak primary healthcare system. METHODS: Twenty six pediatricians and health visitors w...

Descripción completa

Detalles Bibliográficos
Autores principales: Agapidaki, Eirini, Souliotis, Kyriakos, Jackson, Suzanne F, Benetou, Vassiliki, Christogiorgos, Stylianos, Dimitrakaki, Christina, Tountas, Yannis
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3984632/
https://www.ncbi.nlm.nih.gov/pubmed/24725738
http://dx.doi.org/10.1186/1471-244X-14-108
_version_ 1782311459849502720
author Agapidaki, Eirini
Souliotis, Kyriakos
Jackson, Suzanne F
Benetou, Vassiliki
Christogiorgos, Stylianos
Dimitrakaki, Christina
Tountas, Yannis
author_facet Agapidaki, Eirini
Souliotis, Kyriakos
Jackson, Suzanne F
Benetou, Vassiliki
Christogiorgos, Stylianos
Dimitrakaki, Christina
Tountas, Yannis
author_sort Agapidaki, Eirini
collection PubMed
description BACKGROUND: The present study’s aim has been to investigate, identify and interpret the views of pediatric primary healthcare providers on the recognition and management of maternal depression in the context of a weak primary healthcare system. METHODS: Twenty six pediatricians and health visitors were selected by using purposive sampling. Face to face in-depth interviews of approximately 45 minutes duration were conducted. The data were analyzed by using the framework analysis approach which includes five main steps: familiarization, identifying a thematic framework, indexing, charting, mapping and interpretation. RESULTS: Fear of stigmatization came across as a key barrier for detection and management of maternal depression. Pediatric primary health care providers linked their hesitation to start a conversation about depression with stigma. They highlighted that mothers were not receptive to discussing depression and accepting a referral. It was also revealed that the fragmented primary health care system and the lack of collaboration between health and mental health services have resulted in an unfavorable situation towards maternal mental health. CONCLUSIONS: Even though pediatricians and health visitors are aware about maternal depression and the importance of maternal mental health, however they fail to implement detection and management practices successfully. The inefficiently decentralized psychiatric services but also stigmatization and misconceptions about maternal depression have impeded the integration of maternal mental health into primary care and prevent pediatric primary health care providers from implementing detection and management practices.
format Online
Article
Text
id pubmed-3984632
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-39846322014-04-13 Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study Agapidaki, Eirini Souliotis, Kyriakos Jackson, Suzanne F Benetou, Vassiliki Christogiorgos, Stylianos Dimitrakaki, Christina Tountas, Yannis BMC Psychiatry Research Article BACKGROUND: The present study’s aim has been to investigate, identify and interpret the views of pediatric primary healthcare providers on the recognition and management of maternal depression in the context of a weak primary healthcare system. METHODS: Twenty six pediatricians and health visitors were selected by using purposive sampling. Face to face in-depth interviews of approximately 45 minutes duration were conducted. The data were analyzed by using the framework analysis approach which includes five main steps: familiarization, identifying a thematic framework, indexing, charting, mapping and interpretation. RESULTS: Fear of stigmatization came across as a key barrier for detection and management of maternal depression. Pediatric primary health care providers linked their hesitation to start a conversation about depression with stigma. They highlighted that mothers were not receptive to discussing depression and accepting a referral. It was also revealed that the fragmented primary health care system and the lack of collaboration between health and mental health services have resulted in an unfavorable situation towards maternal mental health. CONCLUSIONS: Even though pediatricians and health visitors are aware about maternal depression and the importance of maternal mental health, however they fail to implement detection and management practices successfully. The inefficiently decentralized psychiatric services but also stigmatization and misconceptions about maternal depression have impeded the integration of maternal mental health into primary care and prevent pediatric primary health care providers from implementing detection and management practices. BioMed Central 2014-04-11 /pmc/articles/PMC3984632/ /pubmed/24725738 http://dx.doi.org/10.1186/1471-244X-14-108 Text en Copyright © 2014 Agapidaki et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Agapidaki, Eirini
Souliotis, Kyriakos
Jackson, Suzanne F
Benetou, Vassiliki
Christogiorgos, Stylianos
Dimitrakaki, Christina
Tountas, Yannis
Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study
title Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study
title_full Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study
title_fullStr Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study
title_full_unstemmed Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study
title_short Pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study
title_sort pediatricians’ and health visitors’ views towards detection and management of maternal depression in the context of a weak primary health care system: a qualitative study
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3984632/
https://www.ncbi.nlm.nih.gov/pubmed/24725738
http://dx.doi.org/10.1186/1471-244X-14-108
work_keys_str_mv AT agapidakieirini pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy
AT souliotiskyriakos pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy
AT jacksonsuzannef pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy
AT benetouvassiliki pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy
AT christogiorgosstylianos pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy
AT dimitrakakichristina pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy
AT tountasyannis pediatriciansandhealthvisitorsviewstowardsdetectionandmanagementofmaternaldepressioninthecontextofaweakprimaryhealthcaresystemaqualitativestudy