Cargando…

The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues

The small G protein family Rac has numerous regulators that integrate extracellular signals into tight spatiotemporal maps of its activity to promote specific cell morphologies and responses. Here, we have generated a mouse strain, Rac-FRET, which ubiquitously expresses the Raichu-Rac biosensor. It...

Descripción completa

Detalles Bibliográficos
Autores principales: Johnsson, Anna-Karin E., Dai, Yanfeng, Nobis, Max, Baker, Martin J., McGhee, Ewan J., Walker, Simon, Schwarz, Juliane P., Kadir, Shereen, Morton, Jennifer P., Myant, Kevin B., Huels, David J., Segonds-Pichon, Anne, Sansom, Owen J., Anderson, Kurt I., Timpson, Paul, Welch, Heidi C.E.
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Cell Press 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3988842/
https://www.ncbi.nlm.nih.gov/pubmed/24630994
http://dx.doi.org/10.1016/j.celrep.2014.02.024
_version_ 1782312074773266432
author Johnsson, Anna-Karin E.
Dai, Yanfeng
Nobis, Max
Baker, Martin J.
McGhee, Ewan J.
Walker, Simon
Schwarz, Juliane P.
Kadir, Shereen
Morton, Jennifer P.
Myant, Kevin B.
Huels, David J.
Segonds-Pichon, Anne
Sansom, Owen J.
Anderson, Kurt I.
Timpson, Paul
Welch, Heidi C.E.
author_facet Johnsson, Anna-Karin E.
Dai, Yanfeng
Nobis, Max
Baker, Martin J.
McGhee, Ewan J.
Walker, Simon
Schwarz, Juliane P.
Kadir, Shereen
Morton, Jennifer P.
Myant, Kevin B.
Huels, David J.
Segonds-Pichon, Anne
Sansom, Owen J.
Anderson, Kurt I.
Timpson, Paul
Welch, Heidi C.E.
author_sort Johnsson, Anna-Karin E.
collection PubMed
description The small G protein family Rac has numerous regulators that integrate extracellular signals into tight spatiotemporal maps of its activity to promote specific cell morphologies and responses. Here, we have generated a mouse strain, Rac-FRET, which ubiquitously expresses the Raichu-Rac biosensor. It enables FRET imaging and quantification of Rac activity in live tissues and primary cells without affecting cell properties and responses. We assessed Rac activity in chemotaxing Rac-FRET neutrophils and found enrichment in leading-edge protrusions and unexpected longitudinal shifts and oscillations during protruding and stalling phases of migration. We monitored Rac activity in normal or disease states of intestinal, liver, mammary, pancreatic, and skin tissue, in response to stimulation or inhibition and upon genetic manipulation of upstream regulators, revealing unexpected insights into Rac signaling during disease development. The Rac-FRET strain is a resource that promises to fundamentally advance our understanding of Rac-dependent responses in primary cells and native environments.
format Online
Article
Text
id pubmed-3988842
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Cell Press
record_format MEDLINE/PubMed
spelling pubmed-39888422014-04-17 The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues Johnsson, Anna-Karin E. Dai, Yanfeng Nobis, Max Baker, Martin J. McGhee, Ewan J. Walker, Simon Schwarz, Juliane P. Kadir, Shereen Morton, Jennifer P. Myant, Kevin B. Huels, David J. Segonds-Pichon, Anne Sansom, Owen J. Anderson, Kurt I. Timpson, Paul Welch, Heidi C.E. Cell Rep Resource The small G protein family Rac has numerous regulators that integrate extracellular signals into tight spatiotemporal maps of its activity to promote specific cell morphologies and responses. Here, we have generated a mouse strain, Rac-FRET, which ubiquitously expresses the Raichu-Rac biosensor. It enables FRET imaging and quantification of Rac activity in live tissues and primary cells without affecting cell properties and responses. We assessed Rac activity in chemotaxing Rac-FRET neutrophils and found enrichment in leading-edge protrusions and unexpected longitudinal shifts and oscillations during protruding and stalling phases of migration. We monitored Rac activity in normal or disease states of intestinal, liver, mammary, pancreatic, and skin tissue, in response to stimulation or inhibition and upon genetic manipulation of upstream regulators, revealing unexpected insights into Rac signaling during disease development. The Rac-FRET strain is a resource that promises to fundamentally advance our understanding of Rac-dependent responses in primary cells and native environments. Cell Press 2014-03-13 /pmc/articles/PMC3988842/ /pubmed/24630994 http://dx.doi.org/10.1016/j.celrep.2014.02.024 Text en © 2014 The Authors http://creativecommons.org/licenses/by-nc-nd/3.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/3.0/).
spellingShingle Resource
Johnsson, Anna-Karin E.
Dai, Yanfeng
Nobis, Max
Baker, Martin J.
McGhee, Ewan J.
Walker, Simon
Schwarz, Juliane P.
Kadir, Shereen
Morton, Jennifer P.
Myant, Kevin B.
Huels, David J.
Segonds-Pichon, Anne
Sansom, Owen J.
Anderson, Kurt I.
Timpson, Paul
Welch, Heidi C.E.
The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues
title The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues
title_full The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues
title_fullStr The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues
title_full_unstemmed The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues
title_short The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues
title_sort rac-fret mouse reveals tight spatiotemporal control of rac activity in primary cells and tissues
topic Resource
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3988842/
https://www.ncbi.nlm.nih.gov/pubmed/24630994
http://dx.doi.org/10.1016/j.celrep.2014.02.024
work_keys_str_mv AT johnssonannakarine theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT daiyanfeng theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT nobismax theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT bakermartinj theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT mcgheeewanj theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT walkersimon theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT schwarzjulianep theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT kadirshereen theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT mortonjenniferp theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT myantkevinb theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT huelsdavidj theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT segondspichonanne theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT sansomowenj theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT andersonkurti theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT timpsonpaul theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT welchheidice theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT johnssonannakarine racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT daiyanfeng racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT nobismax racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT bakermartinj racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT mcgheeewanj racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT walkersimon racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT schwarzjulianep racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT kadirshereen racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT mortonjenniferp racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT myantkevinb racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT huelsdavidj racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT segondspichonanne racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT sansomowenj racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT andersonkurti racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT timpsonpaul racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues
AT welchheidice racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues