Cargando…
The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues
The small G protein family Rac has numerous regulators that integrate extracellular signals into tight spatiotemporal maps of its activity to promote specific cell morphologies and responses. Here, we have generated a mouse strain, Rac-FRET, which ubiquitously expresses the Raichu-Rac biosensor. It...
Autores principales: | , , , , , , , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Cell Press
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3988842/ https://www.ncbi.nlm.nih.gov/pubmed/24630994 http://dx.doi.org/10.1016/j.celrep.2014.02.024 |
_version_ | 1782312074773266432 |
---|---|
author | Johnsson, Anna-Karin E. Dai, Yanfeng Nobis, Max Baker, Martin J. McGhee, Ewan J. Walker, Simon Schwarz, Juliane P. Kadir, Shereen Morton, Jennifer P. Myant, Kevin B. Huels, David J. Segonds-Pichon, Anne Sansom, Owen J. Anderson, Kurt I. Timpson, Paul Welch, Heidi C.E. |
author_facet | Johnsson, Anna-Karin E. Dai, Yanfeng Nobis, Max Baker, Martin J. McGhee, Ewan J. Walker, Simon Schwarz, Juliane P. Kadir, Shereen Morton, Jennifer P. Myant, Kevin B. Huels, David J. Segonds-Pichon, Anne Sansom, Owen J. Anderson, Kurt I. Timpson, Paul Welch, Heidi C.E. |
author_sort | Johnsson, Anna-Karin E. |
collection | PubMed |
description | The small G protein family Rac has numerous regulators that integrate extracellular signals into tight spatiotemporal maps of its activity to promote specific cell morphologies and responses. Here, we have generated a mouse strain, Rac-FRET, which ubiquitously expresses the Raichu-Rac biosensor. It enables FRET imaging and quantification of Rac activity in live tissues and primary cells without affecting cell properties and responses. We assessed Rac activity in chemotaxing Rac-FRET neutrophils and found enrichment in leading-edge protrusions and unexpected longitudinal shifts and oscillations during protruding and stalling phases of migration. We monitored Rac activity in normal or disease states of intestinal, liver, mammary, pancreatic, and skin tissue, in response to stimulation or inhibition and upon genetic manipulation of upstream regulators, revealing unexpected insights into Rac signaling during disease development. The Rac-FRET strain is a resource that promises to fundamentally advance our understanding of Rac-dependent responses in primary cells and native environments. |
format | Online Article Text |
id | pubmed-3988842 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | Cell Press |
record_format | MEDLINE/PubMed |
spelling | pubmed-39888422014-04-17 The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues Johnsson, Anna-Karin E. Dai, Yanfeng Nobis, Max Baker, Martin J. McGhee, Ewan J. Walker, Simon Schwarz, Juliane P. Kadir, Shereen Morton, Jennifer P. Myant, Kevin B. Huels, David J. Segonds-Pichon, Anne Sansom, Owen J. Anderson, Kurt I. Timpson, Paul Welch, Heidi C.E. Cell Rep Resource The small G protein family Rac has numerous regulators that integrate extracellular signals into tight spatiotemporal maps of its activity to promote specific cell morphologies and responses. Here, we have generated a mouse strain, Rac-FRET, which ubiquitously expresses the Raichu-Rac biosensor. It enables FRET imaging and quantification of Rac activity in live tissues and primary cells without affecting cell properties and responses. We assessed Rac activity in chemotaxing Rac-FRET neutrophils and found enrichment in leading-edge protrusions and unexpected longitudinal shifts and oscillations during protruding and stalling phases of migration. We monitored Rac activity in normal or disease states of intestinal, liver, mammary, pancreatic, and skin tissue, in response to stimulation or inhibition and upon genetic manipulation of upstream regulators, revealing unexpected insights into Rac signaling during disease development. The Rac-FRET strain is a resource that promises to fundamentally advance our understanding of Rac-dependent responses in primary cells and native environments. Cell Press 2014-03-13 /pmc/articles/PMC3988842/ /pubmed/24630994 http://dx.doi.org/10.1016/j.celrep.2014.02.024 Text en © 2014 The Authors http://creativecommons.org/licenses/by-nc-nd/3.0/ This is an open access article under the CC BY-NC-ND license (http://creativecommons.org/licenses/by-nc-nd/3.0/). |
spellingShingle | Resource Johnsson, Anna-Karin E. Dai, Yanfeng Nobis, Max Baker, Martin J. McGhee, Ewan J. Walker, Simon Schwarz, Juliane P. Kadir, Shereen Morton, Jennifer P. Myant, Kevin B. Huels, David J. Segonds-Pichon, Anne Sansom, Owen J. Anderson, Kurt I. Timpson, Paul Welch, Heidi C.E. The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues |
title | The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues |
title_full | The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues |
title_fullStr | The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues |
title_full_unstemmed | The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues |
title_short | The Rac-FRET Mouse Reveals Tight Spatiotemporal Control of Rac Activity in Primary Cells and Tissues |
title_sort | rac-fret mouse reveals tight spatiotemporal control of rac activity in primary cells and tissues |
topic | Resource |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3988842/ https://www.ncbi.nlm.nih.gov/pubmed/24630994 http://dx.doi.org/10.1016/j.celrep.2014.02.024 |
work_keys_str_mv | AT johnssonannakarine theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT daiyanfeng theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT nobismax theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT bakermartinj theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT mcgheeewanj theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT walkersimon theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT schwarzjulianep theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT kadirshereen theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT mortonjenniferp theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT myantkevinb theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT huelsdavidj theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT segondspichonanne theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT sansomowenj theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT andersonkurti theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT timpsonpaul theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT welchheidice theracfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT johnssonannakarine racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT daiyanfeng racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT nobismax racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT bakermartinj racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT mcgheeewanj racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT walkersimon racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT schwarzjulianep racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT kadirshereen racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT mortonjenniferp racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT myantkevinb racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT huelsdavidj racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT segondspichonanne racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT sansomowenj racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT andersonkurti racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT timpsonpaul racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues AT welchheidice racfretmouserevealstightspatiotemporalcontrolofracactivityinprimarycellsandtissues |