Cargando…

The challenges of including sex/gender analysis in systematic reviews: a qualitative survey

BACKGROUND: Systematic review methodology includes the rigorous collection, selection, and evaluation of data in order to synthesize the best available evidence for health practice, health technology assessments, and health policy. Despite evidence that sex and gender matter to health outcomes, data...

Descripción completa

Detalles Bibliográficos
Autores principales: Runnels, Vivien, Tudiver, Sari, Doull, Marion, Boscoe, Madeline
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3990268/
https://www.ncbi.nlm.nih.gov/pubmed/24720875
http://dx.doi.org/10.1186/2046-4053-3-33
_version_ 1782312253139189760
author Runnels, Vivien
Tudiver, Sari
Doull, Marion
Boscoe, Madeline
author_facet Runnels, Vivien
Tudiver, Sari
Doull, Marion
Boscoe, Madeline
author_sort Runnels, Vivien
collection PubMed
description BACKGROUND: Systematic review methodology includes the rigorous collection, selection, and evaluation of data in order to synthesize the best available evidence for health practice, health technology assessments, and health policy. Despite evidence that sex and gender matter to health outcomes, data and analysis related to sex and gender are frequently absent in systematic reviews, raising concerns about the quality and applicability of reviews. Few studies have focused on challenges to implementing sex/gender analysis within systematic reviews. METHODS: A multidisciplinary group of systematic reviewers, methodologists, biomedical and social science researchers, health practitioners, and other health sector professionals completed an open-ended survey prior to a two-day workshop focused on sex/gender, equity, and bias in systematic reviews. Respondents were asked to identify challenging or ‘thorny’ issues associated with integrating sex and gender in systematic reviews and indicate how they address these in their work. Data were analysed using interpretive description. A summary of the findings was presented and discussed with workshop participants. RESULTS: Respondents identified conceptual challenges, such as defining sex and gender, methodological challenges in measuring and analysing sex and gender, challenges related to availability of data and data quality, and practical and policy challenges. No respondents discussed how they addressed these challenges, but all proposed ways to address sex/gender analysis in the future. CONCLUSIONS: Respondents identified a wide range of interrelated challenges to implementing sex/gender considerations within systematic reviews. To our knowledge, this paper is the first to identify these challenges from the perspectives of those conducting and using systematic reviews. A framework and methods to integrate sex/gender analysis in systematic reviews are in the early stages of development. A number of priority items and collaborative initiatives to guide systematic reviewers in sex/gender analysis are provided, based on the survey results and subsequent workshop discussions. An emerging ‘community of practice’ is committed to enhancing the quality and applicability of systematic reviews by integrating considerations of sex/gender into the review process, with the goals of improving health outcomes and ensuring health equity for all persons.
format Online
Article
Text
id pubmed-3990268
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-39902682014-04-18 The challenges of including sex/gender analysis in systematic reviews: a qualitative survey Runnels, Vivien Tudiver, Sari Doull, Marion Boscoe, Madeline Syst Rev Research BACKGROUND: Systematic review methodology includes the rigorous collection, selection, and evaluation of data in order to synthesize the best available evidence for health practice, health technology assessments, and health policy. Despite evidence that sex and gender matter to health outcomes, data and analysis related to sex and gender are frequently absent in systematic reviews, raising concerns about the quality and applicability of reviews. Few studies have focused on challenges to implementing sex/gender analysis within systematic reviews. METHODS: A multidisciplinary group of systematic reviewers, methodologists, biomedical and social science researchers, health practitioners, and other health sector professionals completed an open-ended survey prior to a two-day workshop focused on sex/gender, equity, and bias in systematic reviews. Respondents were asked to identify challenging or ‘thorny’ issues associated with integrating sex and gender in systematic reviews and indicate how they address these in their work. Data were analysed using interpretive description. A summary of the findings was presented and discussed with workshop participants. RESULTS: Respondents identified conceptual challenges, such as defining sex and gender, methodological challenges in measuring and analysing sex and gender, challenges related to availability of data and data quality, and practical and policy challenges. No respondents discussed how they addressed these challenges, but all proposed ways to address sex/gender analysis in the future. CONCLUSIONS: Respondents identified a wide range of interrelated challenges to implementing sex/gender considerations within systematic reviews. To our knowledge, this paper is the first to identify these challenges from the perspectives of those conducting and using systematic reviews. A framework and methods to integrate sex/gender analysis in systematic reviews are in the early stages of development. A number of priority items and collaborative initiatives to guide systematic reviewers in sex/gender analysis are provided, based on the survey results and subsequent workshop discussions. An emerging ‘community of practice’ is committed to enhancing the quality and applicability of systematic reviews by integrating considerations of sex/gender into the review process, with the goals of improving health outcomes and ensuring health equity for all persons. BioMed Central 2014-04-10 /pmc/articles/PMC3990268/ /pubmed/24720875 http://dx.doi.org/10.1186/2046-4053-3-33 Text en Copyright © 2014 Runnels et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Runnels, Vivien
Tudiver, Sari
Doull, Marion
Boscoe, Madeline
The challenges of including sex/gender analysis in systematic reviews: a qualitative survey
title The challenges of including sex/gender analysis in systematic reviews: a qualitative survey
title_full The challenges of including sex/gender analysis in systematic reviews: a qualitative survey
title_fullStr The challenges of including sex/gender analysis in systematic reviews: a qualitative survey
title_full_unstemmed The challenges of including sex/gender analysis in systematic reviews: a qualitative survey
title_short The challenges of including sex/gender analysis in systematic reviews: a qualitative survey
title_sort challenges of including sex/gender analysis in systematic reviews: a qualitative survey
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3990268/
https://www.ncbi.nlm.nih.gov/pubmed/24720875
http://dx.doi.org/10.1186/2046-4053-3-33
work_keys_str_mv AT runnelsvivien thechallengesofincludingsexgenderanalysisinsystematicreviewsaqualitativesurvey
AT tudiversari thechallengesofincludingsexgenderanalysisinsystematicreviewsaqualitativesurvey
AT doullmarion thechallengesofincludingsexgenderanalysisinsystematicreviewsaqualitativesurvey
AT boscoemadeline thechallengesofincludingsexgenderanalysisinsystematicreviewsaqualitativesurvey
AT runnelsvivien challengesofincludingsexgenderanalysisinsystematicreviewsaqualitativesurvey
AT tudiversari challengesofincludingsexgenderanalysisinsystematicreviewsaqualitativesurvey
AT doullmarion challengesofincludingsexgenderanalysisinsystematicreviewsaqualitativesurvey
AT boscoemadeline challengesofincludingsexgenderanalysisinsystematicreviewsaqualitativesurvey