Cargando…
BAFF Receptor Deficiency Limits Gammaherpesvirus Infection
Lymphocyte colonization by gammaherpesviruses (γHVs) is an important target for cancer prevention. However, how it works is not clear. Epstein-Barr virus drives autonomous B cell proliferation in vitro but in vivo may more subtly exploit the proliferative pathways provided by lymphoid germinal cente...
Autores principales: | , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
American Society for Microbiology
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3993772/ https://www.ncbi.nlm.nih.gov/pubmed/24501409 http://dx.doi.org/10.1128/JVI.03497-13 |
_version_ | 1782312621741965312 |
---|---|
author | Frederico, Bruno May, Janet S. Efstathiou, Stacey Stevenson, Philip G. |
author_facet | Frederico, Bruno May, Janet S. Efstathiou, Stacey Stevenson, Philip G. |
author_sort | Frederico, Bruno |
collection | PubMed |
description | Lymphocyte colonization by gammaherpesviruses (γHVs) is an important target for cancer prevention. However, how it works is not clear. Epstein-Barr virus drives autonomous B cell proliferation in vitro but in vivo may more subtly exploit the proliferative pathways provided by lymphoid germinal centers (GCs). Murid herpesvirus 4 (MuHV-4), which realistically infects inbred mice, provides a useful tool with which to understand further how a γHV colonizes B cells in vivo. Not all γHVs necessarily behave the same, but common events can with MuHV-4 be assigned an importance for host colonization and so a potential as therapeutic targets. MuHV-4-driven B cell proliferation depends quantitatively on CD4(+) T cell help. Here we show that it also depends on T cell-independent survival signals provided by the B cell-activating factor (BAFF) receptor (BAFF-R). B cells could be infected in BAFF-R(−/−) mice, but virus loads remained low. This corresponded to a BAFF-R-dependent defect in GC colonization. The close parallels between normal, antigen-driven B cell responses and virus-infected B cell proliferation argue that in vivo, γHVs mostly induce infected B cells into normal GC reactions rather than generating large numbers of autonomously proliferating blasts. IMPORTANCE γHVs cause cancers by driving the proliferation of infected cells. B cells are a particular target. Thus, we need to know how virus-driven B cell proliferation works. Controversy exists as to whether viral genes drive it directly or less directly orchestrate the engagement of normal, host-driven pathways. Here we show that the B cell proliferation driven by a murid γHV requires BAFF-R. This supports the idea that γHVs exploit host proliferation pathways and suggests that interfering with BAFF-R could more generally reduce γHV-associated B cell proliferation. |
format | Online Article Text |
id | pubmed-3993772 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | American Society for Microbiology |
record_format | MEDLINE/PubMed |
spelling | pubmed-39937722014-05-23 BAFF Receptor Deficiency Limits Gammaherpesvirus Infection Frederico, Bruno May, Janet S. Efstathiou, Stacey Stevenson, Philip G. J Virol Pathogenesis and Immunity Lymphocyte colonization by gammaherpesviruses (γHVs) is an important target for cancer prevention. However, how it works is not clear. Epstein-Barr virus drives autonomous B cell proliferation in vitro but in vivo may more subtly exploit the proliferative pathways provided by lymphoid germinal centers (GCs). Murid herpesvirus 4 (MuHV-4), which realistically infects inbred mice, provides a useful tool with which to understand further how a γHV colonizes B cells in vivo. Not all γHVs necessarily behave the same, but common events can with MuHV-4 be assigned an importance for host colonization and so a potential as therapeutic targets. MuHV-4-driven B cell proliferation depends quantitatively on CD4(+) T cell help. Here we show that it also depends on T cell-independent survival signals provided by the B cell-activating factor (BAFF) receptor (BAFF-R). B cells could be infected in BAFF-R(−/−) mice, but virus loads remained low. This corresponded to a BAFF-R-dependent defect in GC colonization. The close parallels between normal, antigen-driven B cell responses and virus-infected B cell proliferation argue that in vivo, γHVs mostly induce infected B cells into normal GC reactions rather than generating large numbers of autonomously proliferating blasts. IMPORTANCE γHVs cause cancers by driving the proliferation of infected cells. B cells are a particular target. Thus, we need to know how virus-driven B cell proliferation works. Controversy exists as to whether viral genes drive it directly or less directly orchestrate the engagement of normal, host-driven pathways. Here we show that the B cell proliferation driven by a murid γHV requires BAFF-R. This supports the idea that γHVs exploit host proliferation pathways and suggests that interfering with BAFF-R could more generally reduce γHV-associated B cell proliferation. American Society for Microbiology 2014-04 /pmc/articles/PMC3993772/ /pubmed/24501409 http://dx.doi.org/10.1128/JVI.03497-13 Text en Copyright © 2014 Frederico et al. http://creativecommons.org/licenses/by/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution 3.0 Unported license (http://creativecommons.org/licenses/by/3.0/) . |
spellingShingle | Pathogenesis and Immunity Frederico, Bruno May, Janet S. Efstathiou, Stacey Stevenson, Philip G. BAFF Receptor Deficiency Limits Gammaherpesvirus Infection |
title | BAFF Receptor Deficiency Limits Gammaherpesvirus Infection |
title_full | BAFF Receptor Deficiency Limits Gammaherpesvirus Infection |
title_fullStr | BAFF Receptor Deficiency Limits Gammaherpesvirus Infection |
title_full_unstemmed | BAFF Receptor Deficiency Limits Gammaherpesvirus Infection |
title_short | BAFF Receptor Deficiency Limits Gammaherpesvirus Infection |
title_sort | baff receptor deficiency limits gammaherpesvirus infection |
topic | Pathogenesis and Immunity |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3993772/ https://www.ncbi.nlm.nih.gov/pubmed/24501409 http://dx.doi.org/10.1128/JVI.03497-13 |
work_keys_str_mv | AT fredericobruno baffreceptordeficiencylimitsgammaherpesvirusinfection AT mayjanets baffreceptordeficiencylimitsgammaherpesvirusinfection AT efstathioustacey baffreceptordeficiencylimitsgammaherpesvirusinfection AT stevensonphilipg baffreceptordeficiencylimitsgammaherpesvirusinfection |