Cargando…

Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report

INTRODUCTION: Although several etiopathogenetic mechanisms have been proposed, the causes of left ventricular apical ballooning syndrome are still controversial. CASE PRESENTATION: A 51-year-old Japanese woman consulted the emergency room complaining of the sudden onset of anterior chest pain while...

Descripción completa

Detalles Bibliográficos
Autores principales: Nomura, Tetsuya, Keira, Natsuya, Taminishi, Shunta, Kubota, Hiroshi, Higuchi, Yusuke, Ikegame, Sho, Terada, Kensuke, Kato, Taku, Urakabe, Yota, Tatsumi, Tetsuya
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3994524/
https://www.ncbi.nlm.nih.gov/pubmed/24716472
http://dx.doi.org/10.1186/1752-1947-8-124
_version_ 1782312744016412672
author Nomura, Tetsuya
Keira, Natsuya
Taminishi, Shunta
Kubota, Hiroshi
Higuchi, Yusuke
Ikegame, Sho
Terada, Kensuke
Kato, Taku
Urakabe, Yota
Tatsumi, Tetsuya
author_facet Nomura, Tetsuya
Keira, Natsuya
Taminishi, Shunta
Kubota, Hiroshi
Higuchi, Yusuke
Ikegame, Sho
Terada, Kensuke
Kato, Taku
Urakabe, Yota
Tatsumi, Tetsuya
author_sort Nomura, Tetsuya
collection PubMed
description INTRODUCTION: Although several etiopathogenetic mechanisms have been proposed, the causes of left ventricular apical ballooning syndrome are still controversial. CASE PRESENTATION: A 51-year-old Japanese woman consulted the emergency room complaining of the sudden onset of anterior chest pain while shopping. We initially suspected her disease as left ventricular apical ballooning syndrome based on her clinical background and laboratory examinations. However, the initial coronary angiogram demonstrated diffuse lesions in her distal left anterior descending coronary artery, and she was finally diagnosed with apical myocardial infarction. The blood flow in her distal left anterior descending coronary artery had markedly improved in the chronic phase. If the reduced blood flow in her distal left anterior descending coronary artery was induced by coronary vasospasm and the vasospasm was relieved before the coronary angiogram was performed, this case must be diagnosed as left ventricular apical ballooning syndrome. CONCLUSION: We think this case may promote discussion regarding the pathophysiology of left ventricular apical ballooning syndrome.
format Online
Article
Text
id pubmed-3994524
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-39945242014-04-23 Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report Nomura, Tetsuya Keira, Natsuya Taminishi, Shunta Kubota, Hiroshi Higuchi, Yusuke Ikegame, Sho Terada, Kensuke Kato, Taku Urakabe, Yota Tatsumi, Tetsuya J Med Case Rep Case Report INTRODUCTION: Although several etiopathogenetic mechanisms have been proposed, the causes of left ventricular apical ballooning syndrome are still controversial. CASE PRESENTATION: A 51-year-old Japanese woman consulted the emergency room complaining of the sudden onset of anterior chest pain while shopping. We initially suspected her disease as left ventricular apical ballooning syndrome based on her clinical background and laboratory examinations. However, the initial coronary angiogram demonstrated diffuse lesions in her distal left anterior descending coronary artery, and she was finally diagnosed with apical myocardial infarction. The blood flow in her distal left anterior descending coronary artery had markedly improved in the chronic phase. If the reduced blood flow in her distal left anterior descending coronary artery was induced by coronary vasospasm and the vasospasm was relieved before the coronary angiogram was performed, this case must be diagnosed as left ventricular apical ballooning syndrome. CONCLUSION: We think this case may promote discussion regarding the pathophysiology of left ventricular apical ballooning syndrome. BioMed Central 2014-04-09 /pmc/articles/PMC3994524/ /pubmed/24716472 http://dx.doi.org/10.1186/1752-1947-8-124 Text en Copyright © 2014 Nomura et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Nomura, Tetsuya
Keira, Natsuya
Taminishi, Shunta
Kubota, Hiroshi
Higuchi, Yusuke
Ikegame, Sho
Terada, Kensuke
Kato, Taku
Urakabe, Yota
Tatsumi, Tetsuya
Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report
title Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report
title_full Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report
title_fullStr Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report
title_full_unstemmed Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report
title_short Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report
title_sort apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3994524/
https://www.ncbi.nlm.nih.gov/pubmed/24716472
http://dx.doi.org/10.1186/1752-1947-8-124
work_keys_str_mv AT nomuratetsuya apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT keiranatsuya apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT taminishishunta apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT kubotahiroshi apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT higuchiyusuke apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT ikegamesho apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT teradakensuke apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT katotaku apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT urakabeyota apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport
AT tatsumitetsuya apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport