Cargando…
Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report
INTRODUCTION: Although several etiopathogenetic mechanisms have been proposed, the causes of left ventricular apical ballooning syndrome are still controversial. CASE PRESENTATION: A 51-year-old Japanese woman consulted the emergency room complaining of the sudden onset of anterior chest pain while...
Autores principales: | , , , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3994524/ https://www.ncbi.nlm.nih.gov/pubmed/24716472 http://dx.doi.org/10.1186/1752-1947-8-124 |
_version_ | 1782312744016412672 |
---|---|
author | Nomura, Tetsuya Keira, Natsuya Taminishi, Shunta Kubota, Hiroshi Higuchi, Yusuke Ikegame, Sho Terada, Kensuke Kato, Taku Urakabe, Yota Tatsumi, Tetsuya |
author_facet | Nomura, Tetsuya Keira, Natsuya Taminishi, Shunta Kubota, Hiroshi Higuchi, Yusuke Ikegame, Sho Terada, Kensuke Kato, Taku Urakabe, Yota Tatsumi, Tetsuya |
author_sort | Nomura, Tetsuya |
collection | PubMed |
description | INTRODUCTION: Although several etiopathogenetic mechanisms have been proposed, the causes of left ventricular apical ballooning syndrome are still controversial. CASE PRESENTATION: A 51-year-old Japanese woman consulted the emergency room complaining of the sudden onset of anterior chest pain while shopping. We initially suspected her disease as left ventricular apical ballooning syndrome based on her clinical background and laboratory examinations. However, the initial coronary angiogram demonstrated diffuse lesions in her distal left anterior descending coronary artery, and she was finally diagnosed with apical myocardial infarction. The blood flow in her distal left anterior descending coronary artery had markedly improved in the chronic phase. If the reduced blood flow in her distal left anterior descending coronary artery was induced by coronary vasospasm and the vasospasm was relieved before the coronary angiogram was performed, this case must be diagnosed as left ventricular apical ballooning syndrome. CONCLUSION: We think this case may promote discussion regarding the pathophysiology of left ventricular apical ballooning syndrome. |
format | Online Article Text |
id | pubmed-3994524 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-39945242014-04-23 Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report Nomura, Tetsuya Keira, Natsuya Taminishi, Shunta Kubota, Hiroshi Higuchi, Yusuke Ikegame, Sho Terada, Kensuke Kato, Taku Urakabe, Yota Tatsumi, Tetsuya J Med Case Rep Case Report INTRODUCTION: Although several etiopathogenetic mechanisms have been proposed, the causes of left ventricular apical ballooning syndrome are still controversial. CASE PRESENTATION: A 51-year-old Japanese woman consulted the emergency room complaining of the sudden onset of anterior chest pain while shopping. We initially suspected her disease as left ventricular apical ballooning syndrome based on her clinical background and laboratory examinations. However, the initial coronary angiogram demonstrated diffuse lesions in her distal left anterior descending coronary artery, and she was finally diagnosed with apical myocardial infarction. The blood flow in her distal left anterior descending coronary artery had markedly improved in the chronic phase. If the reduced blood flow in her distal left anterior descending coronary artery was induced by coronary vasospasm and the vasospasm was relieved before the coronary angiogram was performed, this case must be diagnosed as left ventricular apical ballooning syndrome. CONCLUSION: We think this case may promote discussion regarding the pathophysiology of left ventricular apical ballooning syndrome. BioMed Central 2014-04-09 /pmc/articles/PMC3994524/ /pubmed/24716472 http://dx.doi.org/10.1186/1752-1947-8-124 Text en Copyright © 2014 Nomura et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Nomura, Tetsuya Keira, Natsuya Taminishi, Shunta Kubota, Hiroshi Higuchi, Yusuke Ikegame, Sho Terada, Kensuke Kato, Taku Urakabe, Yota Tatsumi, Tetsuya Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report |
title | Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report |
title_full | Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report |
title_fullStr | Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report |
title_full_unstemmed | Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report |
title_short | Apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report |
title_sort | apical myocardial infarction with bizarre coronary images mimicking left ventricular apical ballooning syndrome: a case report |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3994524/ https://www.ncbi.nlm.nih.gov/pubmed/24716472 http://dx.doi.org/10.1186/1752-1947-8-124 |
work_keys_str_mv | AT nomuratetsuya apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT keiranatsuya apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT taminishishunta apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT kubotahiroshi apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT higuchiyusuke apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT ikegamesho apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT teradakensuke apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT katotaku apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT urakabeyota apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport AT tatsumitetsuya apicalmyocardialinfarctionwithbizarrecoronaryimagesmimickingleftventricularapicalballooningsyndromeacasereport |