Cargando…

Intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats

BACKGROUND: Emulsified isoflurane (EIso) is a novel intravenous general anesthetic, which can provide rapid anesthetic induction and recovery. EIso preconditioning could attenuate heart, lung and liver ischemia/reperfusion (I/R) injury. We tested the hypothesis that intravenous pretreatment with EIs...

Descripción completa

Detalles Bibliográficos
Autores principales: Qin, Zhaojun, Lv, En, Zhan, Leyun, Xing, Xiangfei, Jiang, Jianli, Zhang, Min
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3996162/
https://www.ncbi.nlm.nih.gov/pubmed/24739487
http://dx.doi.org/10.1186/1471-2253-14-28
_version_ 1782313001586524160
author Qin, Zhaojun
Lv, En
Zhan, Leyun
Xing, Xiangfei
Jiang, Jianli
Zhang, Min
author_facet Qin, Zhaojun
Lv, En
Zhan, Leyun
Xing, Xiangfei
Jiang, Jianli
Zhang, Min
author_sort Qin, Zhaojun
collection PubMed
description BACKGROUND: Emulsified isoflurane (EIso) is a novel intravenous general anesthetic, which can provide rapid anesthetic induction and recovery. EIso preconditioning could attenuate heart, lung and liver ischemia/reperfusion (I/R) injury. We tested the hypothesis that intravenous pretreatment with EIso would protect kidneys against I/R injury by inhibiting systemic inflammatory responses and improving renal antioxidative ability. METHODS: Rats were randomly divided into these six groups: sham, I/R, intralipid, 1, 2 or 4 ml/kg EIso. Rats were subjected to 45 min left renal pedicle occlusion followed by 3 h reperfusion after right nephrectomy. Rat were treated with intravenous 8% EIso with 1, 2 or 4 ml/kg, or 30% intralipid with 2 ml/kg for 30 min before ischemia, respectively. After reperfusion, renal functional parameters, serum mediator concentrations and markers of oxidative stress in kidney tissues were determined, and renal histopathological analysis were performed. RESULTS: Serum creatinine, blood urea nitrogen, cystatin c, tumor necrosis factor-α, interleukin-6, and interleukin-10 concentrations were significantly increased after renal I/R as compared to the sham group. So was renal tissue MDA content and histological scores, but renal tissue SOD activity was decreased. Additionally, severe morphological damages were observed in these study groups. In contrast, 2 or 4 ml/kg EIso reduced serum creatinine, blood urea nitrogen, cystatin c, tumor necrosis factor-α, and interleukin-6 levels, decreased renal tissue MDA content and histological scores, increased serum interleukin-10 level and tissue SOD activity as compared to the I/R, intralipid and 1 ml/kg EIso groups. Renal morphological damages were alleviated after pretreatment of 2 or 4 ml/kg EIso. CONCLUSIONS: Intravenous EIso produces preconditioning against renal I/R injury in rats, which might be mediated by attenuating inflammation and increasing antioxidation ability.
format Online
Article
Text
id pubmed-3996162
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-39961622014-04-24 Intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats Qin, Zhaojun Lv, En Zhan, Leyun Xing, Xiangfei Jiang, Jianli Zhang, Min BMC Anesthesiol Research Article BACKGROUND: Emulsified isoflurane (EIso) is a novel intravenous general anesthetic, which can provide rapid anesthetic induction and recovery. EIso preconditioning could attenuate heart, lung and liver ischemia/reperfusion (I/R) injury. We tested the hypothesis that intravenous pretreatment with EIso would protect kidneys against I/R injury by inhibiting systemic inflammatory responses and improving renal antioxidative ability. METHODS: Rats were randomly divided into these six groups: sham, I/R, intralipid, 1, 2 or 4 ml/kg EIso. Rats were subjected to 45 min left renal pedicle occlusion followed by 3 h reperfusion after right nephrectomy. Rat were treated with intravenous 8% EIso with 1, 2 or 4 ml/kg, or 30% intralipid with 2 ml/kg for 30 min before ischemia, respectively. After reperfusion, renal functional parameters, serum mediator concentrations and markers of oxidative stress in kidney tissues were determined, and renal histopathological analysis were performed. RESULTS: Serum creatinine, blood urea nitrogen, cystatin c, tumor necrosis factor-α, interleukin-6, and interleukin-10 concentrations were significantly increased after renal I/R as compared to the sham group. So was renal tissue MDA content and histological scores, but renal tissue SOD activity was decreased. Additionally, severe morphological damages were observed in these study groups. In contrast, 2 or 4 ml/kg EIso reduced serum creatinine, blood urea nitrogen, cystatin c, tumor necrosis factor-α, and interleukin-6 levels, decreased renal tissue MDA content and histological scores, increased serum interleukin-10 level and tissue SOD activity as compared to the I/R, intralipid and 1 ml/kg EIso groups. Renal morphological damages were alleviated after pretreatment of 2 or 4 ml/kg EIso. CONCLUSIONS: Intravenous EIso produces preconditioning against renal I/R injury in rats, which might be mediated by attenuating inflammation and increasing antioxidation ability. BioMed Central 2014-04-16 /pmc/articles/PMC3996162/ /pubmed/24739487 http://dx.doi.org/10.1186/1471-2253-14-28 Text en Copyright © 2014 Qin et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Qin, Zhaojun
Lv, En
Zhan, Leyun
Xing, Xiangfei
Jiang, Jianli
Zhang, Min
Intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats
title Intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats
title_full Intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats
title_fullStr Intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats
title_full_unstemmed Intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats
title_short Intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats
title_sort intravenous pretreatment with emulsified isoflurane preconditioning protects kidneys against ischemia/reperfusion injury in rats
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC3996162/
https://www.ncbi.nlm.nih.gov/pubmed/24739487
http://dx.doi.org/10.1186/1471-2253-14-28
work_keys_str_mv AT qinzhaojun intravenouspretreatmentwithemulsifiedisofluranepreconditioningprotectskidneysagainstischemiareperfusioninjuryinrats
AT lven intravenouspretreatmentwithemulsifiedisofluranepreconditioningprotectskidneysagainstischemiareperfusioninjuryinrats
AT zhanleyun intravenouspretreatmentwithemulsifiedisofluranepreconditioningprotectskidneysagainstischemiareperfusioninjuryinrats
AT xingxiangfei intravenouspretreatmentwithemulsifiedisofluranepreconditioningprotectskidneysagainstischemiareperfusioninjuryinrats
AT jiangjianli intravenouspretreatmentwithemulsifiedisofluranepreconditioningprotectskidneysagainstischemiareperfusioninjuryinrats
AT zhangmin intravenouspretreatmentwithemulsifiedisofluranepreconditioningprotectskidneysagainstischemiareperfusioninjuryinrats