Cargando…

Genome-wide SNP analysis of the Systemic Capillary Leak Syndrome (Clarkson disease)

The Systemic Capillary Leak Syndrome (SCLS) is an extremely rare, orphan disease that resembles, and is frequently erroneously diagnosed as, systemic anaphylaxis. The disorder is characterized by repeated, transient, and seemingly unprovoked episodes of hypotensive shock and peripheral edema due to...

Descripción completa

Detalles Bibliográficos
Autores principales: Xie, Zhihui, Nagarajan, Vijayaraj, Sturdevant, Daniel E, Iwaki, Shoko, Chan, Eunice, Wisch, Laura, Young, Michael, Nelson, Celeste M, Porcella, Stephen F, Druey, Kirk M
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Landes Bioscience 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4009617/
https://www.ncbi.nlm.nih.gov/pubmed/24808988
http://dx.doi.org/10.4161/rdis.27445
_version_ 1782479780815306752
author Xie, Zhihui
Nagarajan, Vijayaraj
Sturdevant, Daniel E
Iwaki, Shoko
Chan, Eunice
Wisch, Laura
Young, Michael
Nelson, Celeste M
Porcella, Stephen F
Druey, Kirk M
author_facet Xie, Zhihui
Nagarajan, Vijayaraj
Sturdevant, Daniel E
Iwaki, Shoko
Chan, Eunice
Wisch, Laura
Young, Michael
Nelson, Celeste M
Porcella, Stephen F
Druey, Kirk M
author_sort Xie, Zhihui
collection PubMed
description The Systemic Capillary Leak Syndrome (SCLS) is an extremely rare, orphan disease that resembles, and is frequently erroneously diagnosed as, systemic anaphylaxis. The disorder is characterized by repeated, transient, and seemingly unprovoked episodes of hypotensive shock and peripheral edema due to transient endothelial hyperpermeability. SCLS is often accompanied by a monoclonal gammopathy of unknown significance (MGUS). Using Affymetrix Single Nucleotide Polymorphism (SNP) microarrays, we performed the first genome-wide SNP analysis of SCLS in a cohort of 12 disease subjects and 18 controls. Exome capture sequencing was performed on genomic DNA from nine of these patients as validation for the SNP-chip discoveries and de novo data generation. We identified candidate susceptibility loci for SCLS, which included a region flanking CAV3 (3p25.3) as well as SNP clusters in PON1 (7q21.3), PSORS1C1 (6p21.3), and CHCHD3 (7q33). Among the most highly ranked discoveries were gene-associated SNPs in the uncharacterized LOC100130480 gene (rs6417039, rs2004296). Top case-associated SNPs were observed in BTRC (rs12355803, 3rs4436485), ARHGEF18 (rs11668246), CDH13 (rs4782779), and EDG2 (rs12552348), which encode proteins with known or suspected roles in B cell function and/or vascular integrity. 61 SNPs that were significantly associated with SCLS by microarray analysis were also detected and validated by exome deep sequencing. Functional annotation of highly ranked SNPs revealed enrichment of cell projections, cell junctions and adhesion, and molecules containing pleckstrin homology, Ras/Rho regulatory, and immunoglobulin Ig-like C2/fibronectin type III domains, all of which involve mechanistic functions that correlate with the SCLS phenotype. These results highlight SNPs with potential relevance to SCLS.
format Online
Article
Text
id pubmed-4009617
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher Landes Bioscience
record_format MEDLINE/PubMed
spelling pubmed-40096172014-05-05 Genome-wide SNP analysis of the Systemic Capillary Leak Syndrome (Clarkson disease) Xie, Zhihui Nagarajan, Vijayaraj Sturdevant, Daniel E Iwaki, Shoko Chan, Eunice Wisch, Laura Young, Michael Nelson, Celeste M Porcella, Stephen F Druey, Kirk M Rare Dis Research Paper The Systemic Capillary Leak Syndrome (SCLS) is an extremely rare, orphan disease that resembles, and is frequently erroneously diagnosed as, systemic anaphylaxis. The disorder is characterized by repeated, transient, and seemingly unprovoked episodes of hypotensive shock and peripheral edema due to transient endothelial hyperpermeability. SCLS is often accompanied by a monoclonal gammopathy of unknown significance (MGUS). Using Affymetrix Single Nucleotide Polymorphism (SNP) microarrays, we performed the first genome-wide SNP analysis of SCLS in a cohort of 12 disease subjects and 18 controls. Exome capture sequencing was performed on genomic DNA from nine of these patients as validation for the SNP-chip discoveries and de novo data generation. We identified candidate susceptibility loci for SCLS, which included a region flanking CAV3 (3p25.3) as well as SNP clusters in PON1 (7q21.3), PSORS1C1 (6p21.3), and CHCHD3 (7q33). Among the most highly ranked discoveries were gene-associated SNPs in the uncharacterized LOC100130480 gene (rs6417039, rs2004296). Top case-associated SNPs were observed in BTRC (rs12355803, 3rs4436485), ARHGEF18 (rs11668246), CDH13 (rs4782779), and EDG2 (rs12552348), which encode proteins with known or suspected roles in B cell function and/or vascular integrity. 61 SNPs that were significantly associated with SCLS by microarray analysis were also detected and validated by exome deep sequencing. Functional annotation of highly ranked SNPs revealed enrichment of cell projections, cell junctions and adhesion, and molecules containing pleckstrin homology, Ras/Rho regulatory, and immunoglobulin Ig-like C2/fibronectin type III domains, all of which involve mechanistic functions that correlate with the SCLS phenotype. These results highlight SNPs with potential relevance to SCLS. Landes Bioscience 2013-12-12 /pmc/articles/PMC4009617/ /pubmed/24808988 http://dx.doi.org/10.4161/rdis.27445 Text en Copyright © 2013 Landes Bioscience http://creativecommons.org/licenses/by-nc/3.0/ This is an open-access article licensed under a Creative Commons Attribution-NonCommercial 3.0 Unported License. The article may be redistributed, reproduced, and reused for non-commercial purposes, provided the original source is properly cited.
spellingShingle Research Paper
Xie, Zhihui
Nagarajan, Vijayaraj
Sturdevant, Daniel E
Iwaki, Shoko
Chan, Eunice
Wisch, Laura
Young, Michael
Nelson, Celeste M
Porcella, Stephen F
Druey, Kirk M
Genome-wide SNP analysis of the Systemic Capillary Leak Syndrome (Clarkson disease)
title Genome-wide SNP analysis of the Systemic Capillary Leak Syndrome (Clarkson disease)
title_full Genome-wide SNP analysis of the Systemic Capillary Leak Syndrome (Clarkson disease)
title_fullStr Genome-wide SNP analysis of the Systemic Capillary Leak Syndrome (Clarkson disease)
title_full_unstemmed Genome-wide SNP analysis of the Systemic Capillary Leak Syndrome (Clarkson disease)
title_short Genome-wide SNP analysis of the Systemic Capillary Leak Syndrome (Clarkson disease)
title_sort genome-wide snp analysis of the systemic capillary leak syndrome (clarkson disease)
topic Research Paper
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4009617/
https://www.ncbi.nlm.nih.gov/pubmed/24808988
http://dx.doi.org/10.4161/rdis.27445
work_keys_str_mv AT xiezhihui genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT nagarajanvijayaraj genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT sturdevantdaniele genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT iwakishoko genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT chaneunice genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT wischlaura genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT youngmichael genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT nelsoncelestem genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT porcellastephenf genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease
AT drueykirkm genomewidesnpanalysisofthesystemiccapillaryleaksyndromeclarksondisease