Cargando…

The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome

BACKGROUND: The chemokine fractalkine (CX3CL1, FKN) is involved in neural-microglial interactions and is regarded as neuroprotective according to several in vivo studies of inflammatory and degenerative states of the brain. Recently, an association with outcome in human ischemic stroke has been prop...

Descripción completa

Detalles Bibliográficos
Autores principales: Grosse, Gerrit M, Tryc, Anita B, Dirks, Meike, Schuppner, Ramona, Pflugrad, Henning, Lichtinghagen, Ralf, Weissenborn, Karin, Worthmann, Hans
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4022085/
https://www.ncbi.nlm.nih.gov/pubmed/24722201
http://dx.doi.org/10.1186/1742-2094-11-74
_version_ 1782316345898041344
author Grosse, Gerrit M
Tryc, Anita B
Dirks, Meike
Schuppner, Ramona
Pflugrad, Henning
Lichtinghagen, Ralf
Weissenborn, Karin
Worthmann, Hans
author_facet Grosse, Gerrit M
Tryc, Anita B
Dirks, Meike
Schuppner, Ramona
Pflugrad, Henning
Lichtinghagen, Ralf
Weissenborn, Karin
Worthmann, Hans
author_sort Grosse, Gerrit M
collection PubMed
description BACKGROUND: The chemokine fractalkine (CX3CL1, FKN) is involved in neural-microglial interactions and is regarded as neuroprotective according to several in vivo studies of inflammatory and degenerative states of the brain. Recently, an association with outcome in human ischemic stroke has been proposed. In this study, we aimed to investigate the temporal pattern of FKN levels in acute ischemic stroke in relation to stroke severity and outcome. METHODS: FKN levels were measured in plasma specimens of fifty-five patients with acute ischemic stroke. Blood was available for time points 6 hours (h), 12 h, 3 days (d), 7 d and 90 d after stroke onset. Clinical outcome was evaluated using the modified Rankin Scale (mRS) at 7 d and 90 d. RESULTS: The time course of FKN significantly differs depending on stroke severity, with higher FKN levels linked to a lower severity. FKN levels in patients with moderate to severe strokes differ significantly from controls. In outcome analysis, we found an association of dynamics of FKN with clinical outcome. Decrease of FKN is pronounced in patients with worse outcome. Multivariate analysis including stroke severity and stroke etiology revealed that deltaFKN between 6 h and 3 d is independently associated with mRS at 90 d. In addition deltaFKN is inversely correlated with the extent of brain damage, as measured by S100B. CONCLUSIONS: FKN dynamics are independently associated with stroke outcome. Further studies might give insight on whether FKN is actively involved in the inflammatory cascade after acute ischemic stroke.
format Online
Article
Text
id pubmed-4022085
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-40220852014-05-16 The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome Grosse, Gerrit M Tryc, Anita B Dirks, Meike Schuppner, Ramona Pflugrad, Henning Lichtinghagen, Ralf Weissenborn, Karin Worthmann, Hans J Neuroinflammation Research BACKGROUND: The chemokine fractalkine (CX3CL1, FKN) is involved in neural-microglial interactions and is regarded as neuroprotective according to several in vivo studies of inflammatory and degenerative states of the brain. Recently, an association with outcome in human ischemic stroke has been proposed. In this study, we aimed to investigate the temporal pattern of FKN levels in acute ischemic stroke in relation to stroke severity and outcome. METHODS: FKN levels were measured in plasma specimens of fifty-five patients with acute ischemic stroke. Blood was available for time points 6 hours (h), 12 h, 3 days (d), 7 d and 90 d after stroke onset. Clinical outcome was evaluated using the modified Rankin Scale (mRS) at 7 d and 90 d. RESULTS: The time course of FKN significantly differs depending on stroke severity, with higher FKN levels linked to a lower severity. FKN levels in patients with moderate to severe strokes differ significantly from controls. In outcome analysis, we found an association of dynamics of FKN with clinical outcome. Decrease of FKN is pronounced in patients with worse outcome. Multivariate analysis including stroke severity and stroke etiology revealed that deltaFKN between 6 h and 3 d is independently associated with mRS at 90 d. In addition deltaFKN is inversely correlated with the extent of brain damage, as measured by S100B. CONCLUSIONS: FKN dynamics are independently associated with stroke outcome. Further studies might give insight on whether FKN is actively involved in the inflammatory cascade after acute ischemic stroke. BioMed Central 2014-04-10 /pmc/articles/PMC4022085/ /pubmed/24722201 http://dx.doi.org/10.1186/1742-2094-11-74 Text en Copyright © 2014 Grosse et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research
Grosse, Gerrit M
Tryc, Anita B
Dirks, Meike
Schuppner, Ramona
Pflugrad, Henning
Lichtinghagen, Ralf
Weissenborn, Karin
Worthmann, Hans
The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome
title The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome
title_full The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome
title_fullStr The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome
title_full_unstemmed The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome
title_short The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome
title_sort temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome
topic Research
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4022085/
https://www.ncbi.nlm.nih.gov/pubmed/24722201
http://dx.doi.org/10.1186/1742-2094-11-74
work_keys_str_mv AT grossegerritm thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT trycanitab thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT dirksmeike thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT schuppnerramona thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT pflugradhenning thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT lichtinghagenralf thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT weissenbornkarin thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT worthmannhans thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT grossegerritm temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT trycanitab temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT dirksmeike temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT schuppnerramona temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT pflugradhenning temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT lichtinghagenralf temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT weissenbornkarin temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome
AT worthmannhans temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome