Cargando…
The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome
BACKGROUND: The chemokine fractalkine (CX3CL1, FKN) is involved in neural-microglial interactions and is regarded as neuroprotective according to several in vivo studies of inflammatory and degenerative states of the brain. Recently, an association with outcome in human ischemic stroke has been prop...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4022085/ https://www.ncbi.nlm.nih.gov/pubmed/24722201 http://dx.doi.org/10.1186/1742-2094-11-74 |
_version_ | 1782316345898041344 |
---|---|
author | Grosse, Gerrit M Tryc, Anita B Dirks, Meike Schuppner, Ramona Pflugrad, Henning Lichtinghagen, Ralf Weissenborn, Karin Worthmann, Hans |
author_facet | Grosse, Gerrit M Tryc, Anita B Dirks, Meike Schuppner, Ramona Pflugrad, Henning Lichtinghagen, Ralf Weissenborn, Karin Worthmann, Hans |
author_sort | Grosse, Gerrit M |
collection | PubMed |
description | BACKGROUND: The chemokine fractalkine (CX3CL1, FKN) is involved in neural-microglial interactions and is regarded as neuroprotective according to several in vivo studies of inflammatory and degenerative states of the brain. Recently, an association with outcome in human ischemic stroke has been proposed. In this study, we aimed to investigate the temporal pattern of FKN levels in acute ischemic stroke in relation to stroke severity and outcome. METHODS: FKN levels were measured in plasma specimens of fifty-five patients with acute ischemic stroke. Blood was available for time points 6 hours (h), 12 h, 3 days (d), 7 d and 90 d after stroke onset. Clinical outcome was evaluated using the modified Rankin Scale (mRS) at 7 d and 90 d. RESULTS: The time course of FKN significantly differs depending on stroke severity, with higher FKN levels linked to a lower severity. FKN levels in patients with moderate to severe strokes differ significantly from controls. In outcome analysis, we found an association of dynamics of FKN with clinical outcome. Decrease of FKN is pronounced in patients with worse outcome. Multivariate analysis including stroke severity and stroke etiology revealed that deltaFKN between 6 h and 3 d is independently associated with mRS at 90 d. In addition deltaFKN is inversely correlated with the extent of brain damage, as measured by S100B. CONCLUSIONS: FKN dynamics are independently associated with stroke outcome. Further studies might give insight on whether FKN is actively involved in the inflammatory cascade after acute ischemic stroke. |
format | Online Article Text |
id | pubmed-4022085 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-40220852014-05-16 The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome Grosse, Gerrit M Tryc, Anita B Dirks, Meike Schuppner, Ramona Pflugrad, Henning Lichtinghagen, Ralf Weissenborn, Karin Worthmann, Hans J Neuroinflammation Research BACKGROUND: The chemokine fractalkine (CX3CL1, FKN) is involved in neural-microglial interactions and is regarded as neuroprotective according to several in vivo studies of inflammatory and degenerative states of the brain. Recently, an association with outcome in human ischemic stroke has been proposed. In this study, we aimed to investigate the temporal pattern of FKN levels in acute ischemic stroke in relation to stroke severity and outcome. METHODS: FKN levels were measured in plasma specimens of fifty-five patients with acute ischemic stroke. Blood was available for time points 6 hours (h), 12 h, 3 days (d), 7 d and 90 d after stroke onset. Clinical outcome was evaluated using the modified Rankin Scale (mRS) at 7 d and 90 d. RESULTS: The time course of FKN significantly differs depending on stroke severity, with higher FKN levels linked to a lower severity. FKN levels in patients with moderate to severe strokes differ significantly from controls. In outcome analysis, we found an association of dynamics of FKN with clinical outcome. Decrease of FKN is pronounced in patients with worse outcome. Multivariate analysis including stroke severity and stroke etiology revealed that deltaFKN between 6 h and 3 d is independently associated with mRS at 90 d. In addition deltaFKN is inversely correlated with the extent of brain damage, as measured by S100B. CONCLUSIONS: FKN dynamics are independently associated with stroke outcome. Further studies might give insight on whether FKN is actively involved in the inflammatory cascade after acute ischemic stroke. BioMed Central 2014-04-10 /pmc/articles/PMC4022085/ /pubmed/24722201 http://dx.doi.org/10.1186/1742-2094-11-74 Text en Copyright © 2014 Grosse et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Research Grosse, Gerrit M Tryc, Anita B Dirks, Meike Schuppner, Ramona Pflugrad, Henning Lichtinghagen, Ralf Weissenborn, Karin Worthmann, Hans The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome |
title | The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome |
title_full | The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome |
title_fullStr | The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome |
title_full_unstemmed | The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome |
title_short | The temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome |
title_sort | temporal dynamics of plasma fractalkine levels in ischemic stroke: association with clinical severity and outcome |
topic | Research |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4022085/ https://www.ncbi.nlm.nih.gov/pubmed/24722201 http://dx.doi.org/10.1186/1742-2094-11-74 |
work_keys_str_mv | AT grossegerritm thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT trycanitab thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT dirksmeike thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT schuppnerramona thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT pflugradhenning thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT lichtinghagenralf thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT weissenbornkarin thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT worthmannhans thetemporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT grossegerritm temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT trycanitab temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT dirksmeike temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT schuppnerramona temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT pflugradhenning temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT lichtinghagenralf temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT weissenbornkarin temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome AT worthmannhans temporaldynamicsofplasmafractalkinelevelsinischemicstrokeassociationwithclinicalseverityandoutcome |