Cargando…

Serum glycated albumin as a new glycemic marker in pediatric diabetes

PURPOSE: Serum glycated albumin (GA) has been recently used as another glycemic marker that reflects shorter term glycemic control than glycated hemoglobin (HbA1c). Insulin secretory function and glycemic fluctuation might be correlated with the ratio of GA to HbA1c (GA/HbA1c) in diabetic adult pati...

Descripción completa

Detalles Bibliográficos
Autores principales: Lee, Ji Woo, Kim, Hyung Jin, Kwon, Young Se, Jun, Yong Hoon, Kim, Soon Ki, Choi, Jong Weon, Lee, Ji Eun
Formato: Online Artículo Texto
Lenguaje:English
Publicado: The Korean Society of Pediatric Endocrinology 2013
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4027086/
https://www.ncbi.nlm.nih.gov/pubmed/24904879
http://dx.doi.org/10.6065/apem.2013.18.4.208
_version_ 1782316946372427776
author Lee, Ji Woo
Kim, Hyung Jin
Kwon, Young Se
Jun, Yong Hoon
Kim, Soon Ki
Choi, Jong Weon
Lee, Ji Eun
author_facet Lee, Ji Woo
Kim, Hyung Jin
Kwon, Young Se
Jun, Yong Hoon
Kim, Soon Ki
Choi, Jong Weon
Lee, Ji Eun
author_sort Lee, Ji Woo
collection PubMed
description PURPOSE: Serum glycated albumin (GA) has been recently used as another glycemic marker that reflects shorter term glycemic control than glycated hemoglobin (HbA1c). Insulin secretory function and glycemic fluctuation might be correlated with the ratio of GA to HbA1c (GA/HbA1c) in diabetic adult patients. This study investigated the association of GA and GA/HbA1c ratio with the levels of fasting C-peptide, fasting plasma glucose in type 1 and type 2 pediatric diabetes. METHODS: Total 50 cases from 42 patients were included. The subjects were classified into type 1 diabetes mellitus (T1DM) (n=30) and type 2 diabetes mellitus (T2DM) (n=20) group. The associations among HbA1c, GA, and GA/HbA1c ratio were examined. The relationship between the three glycemic indices and fasting glucose, fasting C-peptide were analyzed. RESULTS: Mean values of GA, the GA/HbA1c ratio were significantly higher in T1DM than T2DM. GA (r=0.532, P=0.001), HbA1c (r=0.519, P=0.002) and the GA/HbA1c ratio (r=0.409, P=0.016) were correlated with the fasting plasma glucose. Fasting C-peptide level arranged 4.22±3.22 ng/mL in T2DM, which was significantly above the values in T1DM (0.26±0.49 ng/mL). There were no significant correlation between HbA1c and fasting C-peptide level. However, GA and the GA/HbA1c ratio exhibited inverse correlations with fasting C-peptide level (r=-0.214, P=0.002; r=-0.516, P<0.001). CONCLUSION: GA seems to more accurately reflects fasting plasma glucose level than HbA1c. GA, GA/HbA1c ratio appear to reflect insulin secretory function.
format Online
Article
Text
id pubmed-4027086
institution National Center for Biotechnology Information
language English
publishDate 2013
publisher The Korean Society of Pediatric Endocrinology
record_format MEDLINE/PubMed
spelling pubmed-40270862014-06-05 Serum glycated albumin as a new glycemic marker in pediatric diabetes Lee, Ji Woo Kim, Hyung Jin Kwon, Young Se Jun, Yong Hoon Kim, Soon Ki Choi, Jong Weon Lee, Ji Eun Ann Pediatr Endocrinol Metab Original Article PURPOSE: Serum glycated albumin (GA) has been recently used as another glycemic marker that reflects shorter term glycemic control than glycated hemoglobin (HbA1c). Insulin secretory function and glycemic fluctuation might be correlated with the ratio of GA to HbA1c (GA/HbA1c) in diabetic adult patients. This study investigated the association of GA and GA/HbA1c ratio with the levels of fasting C-peptide, fasting plasma glucose in type 1 and type 2 pediatric diabetes. METHODS: Total 50 cases from 42 patients were included. The subjects were classified into type 1 diabetes mellitus (T1DM) (n=30) and type 2 diabetes mellitus (T2DM) (n=20) group. The associations among HbA1c, GA, and GA/HbA1c ratio were examined. The relationship between the three glycemic indices and fasting glucose, fasting C-peptide were analyzed. RESULTS: Mean values of GA, the GA/HbA1c ratio were significantly higher in T1DM than T2DM. GA (r=0.532, P=0.001), HbA1c (r=0.519, P=0.002) and the GA/HbA1c ratio (r=0.409, P=0.016) were correlated with the fasting plasma glucose. Fasting C-peptide level arranged 4.22±3.22 ng/mL in T2DM, which was significantly above the values in T1DM (0.26±0.49 ng/mL). There were no significant correlation between HbA1c and fasting C-peptide level. However, GA and the GA/HbA1c ratio exhibited inverse correlations with fasting C-peptide level (r=-0.214, P=0.002; r=-0.516, P<0.001). CONCLUSION: GA seems to more accurately reflects fasting plasma glucose level than HbA1c. GA, GA/HbA1c ratio appear to reflect insulin secretory function. The Korean Society of Pediatric Endocrinology 2013-12 2013-12-31 /pmc/articles/PMC4027086/ /pubmed/24904879 http://dx.doi.org/10.6065/apem.2013.18.4.208 Text en © 2013 Annals of Pediatric Endocrinology & Metabolism http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Original Article
Lee, Ji Woo
Kim, Hyung Jin
Kwon, Young Se
Jun, Yong Hoon
Kim, Soon Ki
Choi, Jong Weon
Lee, Ji Eun
Serum glycated albumin as a new glycemic marker in pediatric diabetes
title Serum glycated albumin as a new glycemic marker in pediatric diabetes
title_full Serum glycated albumin as a new glycemic marker in pediatric diabetes
title_fullStr Serum glycated albumin as a new glycemic marker in pediatric diabetes
title_full_unstemmed Serum glycated albumin as a new glycemic marker in pediatric diabetes
title_short Serum glycated albumin as a new glycemic marker in pediatric diabetes
title_sort serum glycated albumin as a new glycemic marker in pediatric diabetes
topic Original Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4027086/
https://www.ncbi.nlm.nih.gov/pubmed/24904879
http://dx.doi.org/10.6065/apem.2013.18.4.208
work_keys_str_mv AT leejiwoo serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes
AT kimhyungjin serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes
AT kwonyoungse serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes
AT junyonghoon serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes
AT kimsoonki serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes
AT choijongweon serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes
AT leejieun serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes