Cargando…
Serum glycated albumin as a new glycemic marker in pediatric diabetes
PURPOSE: Serum glycated albumin (GA) has been recently used as another glycemic marker that reflects shorter term glycemic control than glycated hemoglobin (HbA1c). Insulin secretory function and glycemic fluctuation might be correlated with the ratio of GA to HbA1c (GA/HbA1c) in diabetic adult pati...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
The Korean Society of Pediatric Endocrinology
2013
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4027086/ https://www.ncbi.nlm.nih.gov/pubmed/24904879 http://dx.doi.org/10.6065/apem.2013.18.4.208 |
_version_ | 1782316946372427776 |
---|---|
author | Lee, Ji Woo Kim, Hyung Jin Kwon, Young Se Jun, Yong Hoon Kim, Soon Ki Choi, Jong Weon Lee, Ji Eun |
author_facet | Lee, Ji Woo Kim, Hyung Jin Kwon, Young Se Jun, Yong Hoon Kim, Soon Ki Choi, Jong Weon Lee, Ji Eun |
author_sort | Lee, Ji Woo |
collection | PubMed |
description | PURPOSE: Serum glycated albumin (GA) has been recently used as another glycemic marker that reflects shorter term glycemic control than glycated hemoglobin (HbA1c). Insulin secretory function and glycemic fluctuation might be correlated with the ratio of GA to HbA1c (GA/HbA1c) in diabetic adult patients. This study investigated the association of GA and GA/HbA1c ratio with the levels of fasting C-peptide, fasting plasma glucose in type 1 and type 2 pediatric diabetes. METHODS: Total 50 cases from 42 patients were included. The subjects were classified into type 1 diabetes mellitus (T1DM) (n=30) and type 2 diabetes mellitus (T2DM) (n=20) group. The associations among HbA1c, GA, and GA/HbA1c ratio were examined. The relationship between the three glycemic indices and fasting glucose, fasting C-peptide were analyzed. RESULTS: Mean values of GA, the GA/HbA1c ratio were significantly higher in T1DM than T2DM. GA (r=0.532, P=0.001), HbA1c (r=0.519, P=0.002) and the GA/HbA1c ratio (r=0.409, P=0.016) were correlated with the fasting plasma glucose. Fasting C-peptide level arranged 4.22±3.22 ng/mL in T2DM, which was significantly above the values in T1DM (0.26±0.49 ng/mL). There were no significant correlation between HbA1c and fasting C-peptide level. However, GA and the GA/HbA1c ratio exhibited inverse correlations with fasting C-peptide level (r=-0.214, P=0.002; r=-0.516, P<0.001). CONCLUSION: GA seems to more accurately reflects fasting plasma glucose level than HbA1c. GA, GA/HbA1c ratio appear to reflect insulin secretory function. |
format | Online Article Text |
id | pubmed-4027086 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2013 |
publisher | The Korean Society of Pediatric Endocrinology |
record_format | MEDLINE/PubMed |
spelling | pubmed-40270862014-06-05 Serum glycated albumin as a new glycemic marker in pediatric diabetes Lee, Ji Woo Kim, Hyung Jin Kwon, Young Se Jun, Yong Hoon Kim, Soon Ki Choi, Jong Weon Lee, Ji Eun Ann Pediatr Endocrinol Metab Original Article PURPOSE: Serum glycated albumin (GA) has been recently used as another glycemic marker that reflects shorter term glycemic control than glycated hemoglobin (HbA1c). Insulin secretory function and glycemic fluctuation might be correlated with the ratio of GA to HbA1c (GA/HbA1c) in diabetic adult patients. This study investigated the association of GA and GA/HbA1c ratio with the levels of fasting C-peptide, fasting plasma glucose in type 1 and type 2 pediatric diabetes. METHODS: Total 50 cases from 42 patients were included. The subjects were classified into type 1 diabetes mellitus (T1DM) (n=30) and type 2 diabetes mellitus (T2DM) (n=20) group. The associations among HbA1c, GA, and GA/HbA1c ratio were examined. The relationship between the three glycemic indices and fasting glucose, fasting C-peptide were analyzed. RESULTS: Mean values of GA, the GA/HbA1c ratio were significantly higher in T1DM than T2DM. GA (r=0.532, P=0.001), HbA1c (r=0.519, P=0.002) and the GA/HbA1c ratio (r=0.409, P=0.016) were correlated with the fasting plasma glucose. Fasting C-peptide level arranged 4.22±3.22 ng/mL in T2DM, which was significantly above the values in T1DM (0.26±0.49 ng/mL). There were no significant correlation between HbA1c and fasting C-peptide level. However, GA and the GA/HbA1c ratio exhibited inverse correlations with fasting C-peptide level (r=-0.214, P=0.002; r=-0.516, P<0.001). CONCLUSION: GA seems to more accurately reflects fasting plasma glucose level than HbA1c. GA, GA/HbA1c ratio appear to reflect insulin secretory function. The Korean Society of Pediatric Endocrinology 2013-12 2013-12-31 /pmc/articles/PMC4027086/ /pubmed/24904879 http://dx.doi.org/10.6065/apem.2013.18.4.208 Text en © 2013 Annals of Pediatric Endocrinology & Metabolism http://creativecommons.org/licenses/by-nc/3.0/ This is an Open Access article distributed under the terms of the Creative Commons Attribution Non-Commercial License (http://creativecommons.org/licenses/by-nc/3.0/) which permits unrestricted non-commercial use, distribution, and reproduction in any medium, provided the original work is properly cited. |
spellingShingle | Original Article Lee, Ji Woo Kim, Hyung Jin Kwon, Young Se Jun, Yong Hoon Kim, Soon Ki Choi, Jong Weon Lee, Ji Eun Serum glycated albumin as a new glycemic marker in pediatric diabetes |
title | Serum glycated albumin as a new glycemic marker in pediatric diabetes |
title_full | Serum glycated albumin as a new glycemic marker in pediatric diabetes |
title_fullStr | Serum glycated albumin as a new glycemic marker in pediatric diabetes |
title_full_unstemmed | Serum glycated albumin as a new glycemic marker in pediatric diabetes |
title_short | Serum glycated albumin as a new glycemic marker in pediatric diabetes |
title_sort | serum glycated albumin as a new glycemic marker in pediatric diabetes |
topic | Original Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4027086/ https://www.ncbi.nlm.nih.gov/pubmed/24904879 http://dx.doi.org/10.6065/apem.2013.18.4.208 |
work_keys_str_mv | AT leejiwoo serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes AT kimhyungjin serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes AT kwonyoungse serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes AT junyonghoon serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes AT kimsoonki serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes AT choijongweon serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes AT leejieun serumglycatedalbuminasanewglycemicmarkerinpediatricdiabetes |