Cargando…

Health care needs of cancer survivors in general practice: a systematic review

BACKGROUND: The number of cancer survivors is increasing due to improved treatments. Consequently, general practitioners will treat more and more cancer survivors in the upcoming years. Only little is known about the care needs of these survivors and guidelines to support general practitioners in th...

Descripción completa

Detalles Bibliográficos
Autores principales: Hoekstra, Renske A, Heins, Marianne J, Korevaar, Joke C
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4031325/
https://www.ncbi.nlm.nih.gov/pubmed/24885266
http://dx.doi.org/10.1186/1471-2296-15-94
_version_ 1782317512942157824
author Hoekstra, Renske A
Heins, Marianne J
Korevaar, Joke C
author_facet Hoekstra, Renske A
Heins, Marianne J
Korevaar, Joke C
author_sort Hoekstra, Renske A
collection PubMed
description BACKGROUND: The number of cancer survivors is increasing due to improved treatments. Consequently, general practitioners will treat more and more cancer survivors in the upcoming years. Only little is known about the care needs of these survivors and guidelines to support general practitioners in their treatment of these patients are lacking. The aim of this study was to gain insight in the health care needs of cancer survivors in general practice. METHODS: A systematic review on cancer survivors’ general practice needs was conducted in PubMed, Embase and the Cochrane Library of Systematic Reviews. Eligible studies could be qualitative or quantitative studies examining cancer survivors’ needs in general practice. Studies of adult survivors, with any cancer type, considered free of active disease and no longer receiving active treatment, were included. For each study a quality score was given using a form developed specifically for this study. Statements about survivors’ general practice needs were collected and corresponding themes were grouped. RESULTS: Fifteen studies were included, of which twelve were qualitative. Most mentioned general practice needs were psychosocial needs, mainly being support received form the GP, followed by a need for help with medical issues, and a need for information on cancer, recovery, late treatment effects and on adjusting to life after treatment. CONCLUSIONS: Cancer survivors have different types of general practice needs that are currently not or insufficiently met. This review provides a starting point for the development of new guidelines for general practitioners to support in cancer survivorship.
format Online
Article
Text
id pubmed-4031325
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-40313252014-05-24 Health care needs of cancer survivors in general practice: a systematic review Hoekstra, Renske A Heins, Marianne J Korevaar, Joke C BMC Fam Pract Research Article BACKGROUND: The number of cancer survivors is increasing due to improved treatments. Consequently, general practitioners will treat more and more cancer survivors in the upcoming years. Only little is known about the care needs of these survivors and guidelines to support general practitioners in their treatment of these patients are lacking. The aim of this study was to gain insight in the health care needs of cancer survivors in general practice. METHODS: A systematic review on cancer survivors’ general practice needs was conducted in PubMed, Embase and the Cochrane Library of Systematic Reviews. Eligible studies could be qualitative or quantitative studies examining cancer survivors’ needs in general practice. Studies of adult survivors, with any cancer type, considered free of active disease and no longer receiving active treatment, were included. For each study a quality score was given using a form developed specifically for this study. Statements about survivors’ general practice needs were collected and corresponding themes were grouped. RESULTS: Fifteen studies were included, of which twelve were qualitative. Most mentioned general practice needs were psychosocial needs, mainly being support received form the GP, followed by a need for help with medical issues, and a need for information on cancer, recovery, late treatment effects and on adjusting to life after treatment. CONCLUSIONS: Cancer survivors have different types of general practice needs that are currently not or insufficiently met. This review provides a starting point for the development of new guidelines for general practitioners to support in cancer survivorship. BioMed Central 2014-05-13 /pmc/articles/PMC4031325/ /pubmed/24885266 http://dx.doi.org/10.1186/1471-2296-15-94 Text en Copyright © 2014 Hoekstra et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Hoekstra, Renske A
Heins, Marianne J
Korevaar, Joke C
Health care needs of cancer survivors in general practice: a systematic review
title Health care needs of cancer survivors in general practice: a systematic review
title_full Health care needs of cancer survivors in general practice: a systematic review
title_fullStr Health care needs of cancer survivors in general practice: a systematic review
title_full_unstemmed Health care needs of cancer survivors in general practice: a systematic review
title_short Health care needs of cancer survivors in general practice: a systematic review
title_sort health care needs of cancer survivors in general practice: a systematic review
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4031325/
https://www.ncbi.nlm.nih.gov/pubmed/24885266
http://dx.doi.org/10.1186/1471-2296-15-94
work_keys_str_mv AT hoekstrarenskea healthcareneedsofcancersurvivorsingeneralpracticeasystematicreview
AT heinsmariannej healthcareneedsofcancersurvivorsingeneralpracticeasystematicreview
AT korevaarjokec healthcareneedsofcancersurvivorsingeneralpracticeasystematicreview