Cargando…

The FMRFamide-Like Peptide Family in Nematodes

In the three decades since the FMRFamide peptide was isolated from the mollusk Macrocallista nimbosa, structurally similar peptides sharing a C-terminal RFamide motif have been identified across the animal kingdom. FMRFamide-like peptides (FLPs) represent the largest known family of neuropeptides in...

Descripción completa

Detalles Bibliográficos
Autores principales: Peymen, Katleen, Watteyne, Jan, Frooninckx, Lotte, Schoofs, Liliane, Beets, Isabel
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Frontiers Media S.A. 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4058706/
https://www.ncbi.nlm.nih.gov/pubmed/24982652
http://dx.doi.org/10.3389/fendo.2014.00090
_version_ 1782321162602151936
author Peymen, Katleen
Watteyne, Jan
Frooninckx, Lotte
Schoofs, Liliane
Beets, Isabel
author_facet Peymen, Katleen
Watteyne, Jan
Frooninckx, Lotte
Schoofs, Liliane
Beets, Isabel
author_sort Peymen, Katleen
collection PubMed
description In the three decades since the FMRFamide peptide was isolated from the mollusk Macrocallista nimbosa, structurally similar peptides sharing a C-terminal RFamide motif have been identified across the animal kingdom. FMRFamide-like peptides (FLPs) represent the largest known family of neuropeptides in invertebrates. In the phylum Nematoda, at least 32 flp-genes are classified, making the FLP system of nematodes unusually complex. The diversity of the nematode FLP complement is most extensively mapped in Caenorhabditis elegans, where over 70 FLPs have been predicted. FLPs have shown to be expressed in the majority of the 302 C. elegans neurons including interneurons, sensory neurons, and motor neurons. The vast expression of FLPs is reflected in the broad functional repertoire of nematode FLP signaling, including neuroendocrine and neuromodulatory effects on locomotory activity, reproduction, feeding, and behavior. In contrast to the many identified nematode FLPs, only few peptides have been assigned a receptor and there is the need to clarify the pathway components and working mechanisms of the FLP signaling network. Here, we review the diversity, distribution, and functions of FLPs in nematodes.
format Online
Article
Text
id pubmed-4058706
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Frontiers Media S.A.
record_format MEDLINE/PubMed
spelling pubmed-40587062014-06-30 The FMRFamide-Like Peptide Family in Nematodes Peymen, Katleen Watteyne, Jan Frooninckx, Lotte Schoofs, Liliane Beets, Isabel Front Endocrinol (Lausanne) Endocrinology In the three decades since the FMRFamide peptide was isolated from the mollusk Macrocallista nimbosa, structurally similar peptides sharing a C-terminal RFamide motif have been identified across the animal kingdom. FMRFamide-like peptides (FLPs) represent the largest known family of neuropeptides in invertebrates. In the phylum Nematoda, at least 32 flp-genes are classified, making the FLP system of nematodes unusually complex. The diversity of the nematode FLP complement is most extensively mapped in Caenorhabditis elegans, where over 70 FLPs have been predicted. FLPs have shown to be expressed in the majority of the 302 C. elegans neurons including interneurons, sensory neurons, and motor neurons. The vast expression of FLPs is reflected in the broad functional repertoire of nematode FLP signaling, including neuroendocrine and neuromodulatory effects on locomotory activity, reproduction, feeding, and behavior. In contrast to the many identified nematode FLPs, only few peptides have been assigned a receptor and there is the need to clarify the pathway components and working mechanisms of the FLP signaling network. Here, we review the diversity, distribution, and functions of FLPs in nematodes. Frontiers Media S.A. 2014-06-16 /pmc/articles/PMC4058706/ /pubmed/24982652 http://dx.doi.org/10.3389/fendo.2014.00090 Text en Copyright © 2014 Peymen, Watteyne, Frooninckx, Schoofs and Beets. http://creativecommons.org/licenses/by/3.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License (CC BY). The use, distribution or reproduction in other forums is permitted, provided the original author(s) or licensor are credited and that the original publication in this journal is cited, in accordance with accepted academic practice. No use, distribution or reproduction is permitted which does not comply with these terms.
spellingShingle Endocrinology
Peymen, Katleen
Watteyne, Jan
Frooninckx, Lotte
Schoofs, Liliane
Beets, Isabel
The FMRFamide-Like Peptide Family in Nematodes
title The FMRFamide-Like Peptide Family in Nematodes
title_full The FMRFamide-Like Peptide Family in Nematodes
title_fullStr The FMRFamide-Like Peptide Family in Nematodes
title_full_unstemmed The FMRFamide-Like Peptide Family in Nematodes
title_short The FMRFamide-Like Peptide Family in Nematodes
title_sort fmrfamide-like peptide family in nematodes
topic Endocrinology
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4058706/
https://www.ncbi.nlm.nih.gov/pubmed/24982652
http://dx.doi.org/10.3389/fendo.2014.00090
work_keys_str_mv AT peymenkatleen thefmrfamidelikepeptidefamilyinnematodes
AT watteynejan thefmrfamidelikepeptidefamilyinnematodes
AT frooninckxlotte thefmrfamidelikepeptidefamilyinnematodes
AT schoofsliliane thefmrfamidelikepeptidefamilyinnematodes
AT beetsisabel thefmrfamidelikepeptidefamilyinnematodes
AT peymenkatleen fmrfamidelikepeptidefamilyinnematodes
AT watteynejan fmrfamidelikepeptidefamilyinnematodes
AT frooninckxlotte fmrfamidelikepeptidefamilyinnematodes
AT schoofsliliane fmrfamidelikepeptidefamilyinnematodes
AT beetsisabel fmrfamidelikepeptidefamilyinnematodes