Cargando…
Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism
| Formato: | Online Artículo Texto |
|---|---|
| Lenguaje: | English |
| Publicado: |
Public Library of Science
2014
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4062489/ http://dx.doi.org/10.1371/journal.pone.0101192 |
| _version_ | 1782321660056043520 |
|---|---|
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4062489 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2014 |
| publisher | Public Library of Science |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-40624892014-06-24 Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism PLoS One Correction Public Library of Science 2014-06-18 /pmc/articles/PMC4062489/ http://dx.doi.org/10.1371/journal.pone.0101192 Text en © 2014 The PLOS ONE Staff http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
| spellingShingle | Correction Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism |
| title | Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism |
| title_full | Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism |
| title_fullStr | Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism |
| title_full_unstemmed | Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism |
| title_short | Correction: PHEX Mimetic (SPR4-Peptide) Corrects and Improves HYP and Wild Type Mice Energy-Metabolism |
| title_sort | correction: phex mimetic (spr4-peptide) corrects and improves hyp and wild type mice energy-metabolism |
| topic | Correction |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4062489/ http://dx.doi.org/10.1371/journal.pone.0101192 |
| work_keys_str_mv | AT correctionphexmimeticspr4peptidecorrectsandimproveshypandwildtypemiceenergymetabolism |