Cargando…

Chronic stress induces steatohepatitis while decreases visceral fat mass in mice

BACKGROUND: Prolonged stress leads over time to allostatic load on the body and is likely to exacerbate a disease process. Long-term of stress exposure is one of a risk factor for metabolism-related diseases such as obesity and type 2 diabetes. However, the relationship between chronic stress and no...

Descripción completa

Detalles Bibliográficos
Autores principales: Liu, Yun-Zi, Chen, Ji-Kuai, Zhang, Yi, Wang, Xia, Qu, Shen, Jiang, Chun-Lei
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4070165/
https://www.ncbi.nlm.nih.gov/pubmed/24916323
http://dx.doi.org/10.1186/1471-230X-14-106
_version_ 1782322656925712384
author Liu, Yun-Zi
Chen, Ji-Kuai
Zhang, Yi
Wang, Xia
Qu, Shen
Jiang, Chun-Lei
author_facet Liu, Yun-Zi
Chen, Ji-Kuai
Zhang, Yi
Wang, Xia
Qu, Shen
Jiang, Chun-Lei
author_sort Liu, Yun-Zi
collection PubMed
description BACKGROUND: Prolonged stress leads over time to allostatic load on the body and is likely to exacerbate a disease process. Long-term of stress exposure is one of a risk factor for metabolism-related diseases such as obesity and type 2 diabetes. However, the relationship between chronic stress and non-alcoholic fatty liver disease (NAFLD) remain unknown. METHODS: To address the hypothesis that chronic stress associate to NAFLD development, we subjected C57bl/6 mice to electric foot shock and restraint stress for 12 weeks to set up chronic stress model. Then the serum and hepatic triglyceride (TG), total cholesterol (TC) were measured. Hepatic HE and Oil red O staining were used to specify the state of the NAFLD. To investigate whether inflammation takes part in the stress-induced NAFLD process, related visceral fat, serum and hepatic inflammatory factors were measured. RESULTS: We observed that chronic stress led to an overall increase of hepatic triglyceride and cholesterol while decreasing body weight and visceral fat mass. Microvesicular steatosis, lobular inflammation and ballooning degeneration were seen in stress liver section. This effect was correlated with elevated hepatic and serum inflammatory factors. Although the amount of visceral fat was decreased in stress group, various adipocytokines were elevated. CONCLUSIONS: We showed that chronic stress is associated to NAFLD and chronic inflammation in visceral fat, though food intake and visceral fat mass were decreased. These results may contribute to better understanding of the mechanism from steatosis to steatohepatitis, and propose a novel insight into the prevention and treatment of NAFLD.
format Online
Article
Text
id pubmed-4070165
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-40701652014-06-26 Chronic stress induces steatohepatitis while decreases visceral fat mass in mice Liu, Yun-Zi Chen, Ji-Kuai Zhang, Yi Wang, Xia Qu, Shen Jiang, Chun-Lei BMC Gastroenterol Research Article BACKGROUND: Prolonged stress leads over time to allostatic load on the body and is likely to exacerbate a disease process. Long-term of stress exposure is one of a risk factor for metabolism-related diseases such as obesity and type 2 diabetes. However, the relationship between chronic stress and non-alcoholic fatty liver disease (NAFLD) remain unknown. METHODS: To address the hypothesis that chronic stress associate to NAFLD development, we subjected C57bl/6 mice to electric foot shock and restraint stress for 12 weeks to set up chronic stress model. Then the serum and hepatic triglyceride (TG), total cholesterol (TC) were measured. Hepatic HE and Oil red O staining were used to specify the state of the NAFLD. To investigate whether inflammation takes part in the stress-induced NAFLD process, related visceral fat, serum and hepatic inflammatory factors were measured. RESULTS: We observed that chronic stress led to an overall increase of hepatic triglyceride and cholesterol while decreasing body weight and visceral fat mass. Microvesicular steatosis, lobular inflammation and ballooning degeneration were seen in stress liver section. This effect was correlated with elevated hepatic and serum inflammatory factors. Although the amount of visceral fat was decreased in stress group, various adipocytokines were elevated. CONCLUSIONS: We showed that chronic stress is associated to NAFLD and chronic inflammation in visceral fat, though food intake and visceral fat mass were decreased. These results may contribute to better understanding of the mechanism from steatosis to steatohepatitis, and propose a novel insight into the prevention and treatment of NAFLD. BioMed Central 2014-06-10 /pmc/articles/PMC4070165/ /pubmed/24916323 http://dx.doi.org/10.1186/1471-230X-14-106 Text en Copyright © 2014 Liu et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Research Article
Liu, Yun-Zi
Chen, Ji-Kuai
Zhang, Yi
Wang, Xia
Qu, Shen
Jiang, Chun-Lei
Chronic stress induces steatohepatitis while decreases visceral fat mass in mice
title Chronic stress induces steatohepatitis while decreases visceral fat mass in mice
title_full Chronic stress induces steatohepatitis while decreases visceral fat mass in mice
title_fullStr Chronic stress induces steatohepatitis while decreases visceral fat mass in mice
title_full_unstemmed Chronic stress induces steatohepatitis while decreases visceral fat mass in mice
title_short Chronic stress induces steatohepatitis while decreases visceral fat mass in mice
title_sort chronic stress induces steatohepatitis while decreases visceral fat mass in mice
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4070165/
https://www.ncbi.nlm.nih.gov/pubmed/24916323
http://dx.doi.org/10.1186/1471-230X-14-106
work_keys_str_mv AT liuyunzi chronicstressinducessteatohepatitiswhiledecreasesvisceralfatmassinmice
AT chenjikuai chronicstressinducessteatohepatitiswhiledecreasesvisceralfatmassinmice
AT zhangyi chronicstressinducessteatohepatitiswhiledecreasesvisceralfatmassinmice
AT wangxia chronicstressinducessteatohepatitiswhiledecreasesvisceralfatmassinmice
AT qushen chronicstressinducessteatohepatitiswhiledecreasesvisceralfatmassinmice
AT jiangchunlei chronicstressinducessteatohepatitiswhiledecreasesvisceralfatmassinmice