Cargando…
Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports
INTRODUCTION: Vespa affinis is a hornet widely distributed in Sri Lanka and it is responsible for the highest number of deaths related to Hymenoptera stings. Apart from the early reactions, victims often die in hospital many hours later due to complications such as myocardial infarction and multiple...
Autores principales: | , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
BioMed Central
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4088920/ https://www.ncbi.nlm.nih.gov/pubmed/24929921 http://dx.doi.org/10.1186/1752-1947-8-188 |
_version_ | 1782325055755124736 |
---|---|
author | Kularatne, Keerthi Kannangare, Thamara Jayasena, Ajith Jayasekera, Aruni Waduge, Roshitha Weerakoon, Kosala Kularatne, Senanayake AM |
author_facet | Kularatne, Keerthi Kannangare, Thamara Jayasena, Ajith Jayasekera, Aruni Waduge, Roshitha Weerakoon, Kosala Kularatne, Senanayake AM |
author_sort | Kularatne, Keerthi |
collection | PubMed |
description | INTRODUCTION: Vespa affinis is a hornet widely distributed in Sri Lanka and it is responsible for the highest number of deaths related to Hymenoptera stings. Apart from the early reactions, victims often die in hospital many hours later due to complications such as myocardial infarction and multiple organ failure. Increased microvascular permeability and acute pulmonary oedema as the primary pathology is less known in hornet envenoming. CASE PRESENTATION: Here, we report clinical and postmortem findings of two Sinhalese patients, a 48-year-old husband and his 46-year-old wife, who both died following a massive attack by hornets 32 hours and 9 hours after the incidence respectively. At postmortem examination, both patients had pleural effusions, acute pulmonary oedema and red cell casts in their urine. Their coronary arteries and histology of myocardium were normal. CONCLUSION: Early recognition of acute pulmonary oedema in hornet stings is needed with implementation of crucial treatments to avert deaths. |
format | Online Article Text |
id | pubmed-4088920 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | BioMed Central |
record_format | MEDLINE/PubMed |
spelling | pubmed-40889202014-07-10 Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports Kularatne, Keerthi Kannangare, Thamara Jayasena, Ajith Jayasekera, Aruni Waduge, Roshitha Weerakoon, Kosala Kularatne, Senanayake AM J Med Case Rep Case Report INTRODUCTION: Vespa affinis is a hornet widely distributed in Sri Lanka and it is responsible for the highest number of deaths related to Hymenoptera stings. Apart from the early reactions, victims often die in hospital many hours later due to complications such as myocardial infarction and multiple organ failure. Increased microvascular permeability and acute pulmonary oedema as the primary pathology is less known in hornet envenoming. CASE PRESENTATION: Here, we report clinical and postmortem findings of two Sinhalese patients, a 48-year-old husband and his 46-year-old wife, who both died following a massive attack by hornets 32 hours and 9 hours after the incidence respectively. At postmortem examination, both patients had pleural effusions, acute pulmonary oedema and red cell casts in their urine. Their coronary arteries and histology of myocardium were normal. CONCLUSION: Early recognition of acute pulmonary oedema in hornet stings is needed with implementation of crucial treatments to avert deaths. BioMed Central 2014-06-13 /pmc/articles/PMC4088920/ /pubmed/24929921 http://dx.doi.org/10.1186/1752-1947-8-188 Text en Copyright © 2014 Kularatne et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License ( http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver ( http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
spellingShingle | Case Report Kularatne, Keerthi Kannangare, Thamara Jayasena, Ajith Jayasekera, Aruni Waduge, Roshitha Weerakoon, Kosala Kularatne, Senanayake AM Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports |
title | Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports |
title_full | Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports |
title_fullStr | Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports |
title_full_unstemmed | Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports |
title_short | Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports |
title_sort | fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (vespa affinis) stings in sri lanka: two case reports |
topic | Case Report |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4088920/ https://www.ncbi.nlm.nih.gov/pubmed/24929921 http://dx.doi.org/10.1186/1752-1947-8-188 |
work_keys_str_mv | AT kularatnekeerthi fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports AT kannangarethamara fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports AT jayasenaajith fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports AT jayasekeraaruni fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports AT wadugeroshitha fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports AT weerakoonkosala fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports AT kularatnesenanayakeam fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports |