Cargando…

Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports

INTRODUCTION: Vespa affinis is a hornet widely distributed in Sri Lanka and it is responsible for the highest number of deaths related to Hymenoptera stings. Apart from the early reactions, victims often die in hospital many hours later due to complications such as myocardial infarction and multiple...

Descripción completa

Detalles Bibliográficos
Autores principales: Kularatne, Keerthi, Kannangare, Thamara, Jayasena, Ajith, Jayasekera, Aruni, Waduge, Roshitha, Weerakoon, Kosala, Kularatne, Senanayake AM
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4088920/
https://www.ncbi.nlm.nih.gov/pubmed/24929921
http://dx.doi.org/10.1186/1752-1947-8-188
_version_ 1782325055755124736
author Kularatne, Keerthi
Kannangare, Thamara
Jayasena, Ajith
Jayasekera, Aruni
Waduge, Roshitha
Weerakoon, Kosala
Kularatne, Senanayake AM
author_facet Kularatne, Keerthi
Kannangare, Thamara
Jayasena, Ajith
Jayasekera, Aruni
Waduge, Roshitha
Weerakoon, Kosala
Kularatne, Senanayake AM
author_sort Kularatne, Keerthi
collection PubMed
description INTRODUCTION: Vespa affinis is a hornet widely distributed in Sri Lanka and it is responsible for the highest number of deaths related to Hymenoptera stings. Apart from the early reactions, victims often die in hospital many hours later due to complications such as myocardial infarction and multiple organ failure. Increased microvascular permeability and acute pulmonary oedema as the primary pathology is less known in hornet envenoming. CASE PRESENTATION: Here, we report clinical and postmortem findings of two Sinhalese patients, a 48-year-old husband and his 46-year-old wife, who both died following a massive attack by hornets 32 hours and 9 hours after the incidence respectively. At postmortem examination, both patients had pleural effusions, acute pulmonary oedema and red cell casts in their urine. Their coronary arteries and histology of myocardium were normal. CONCLUSION: Early recognition of acute pulmonary oedema in hornet stings is needed with implementation of crucial treatments to avert deaths.
format Online
Article
Text
id pubmed-4088920
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-40889202014-07-10 Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports Kularatne, Keerthi Kannangare, Thamara Jayasena, Ajith Jayasekera, Aruni Waduge, Roshitha Weerakoon, Kosala Kularatne, Senanayake AM J Med Case Rep Case Report INTRODUCTION: Vespa affinis is a hornet widely distributed in Sri Lanka and it is responsible for the highest number of deaths related to Hymenoptera stings. Apart from the early reactions, victims often die in hospital many hours later due to complications such as myocardial infarction and multiple organ failure. Increased microvascular permeability and acute pulmonary oedema as the primary pathology is less known in hornet envenoming. CASE PRESENTATION: Here, we report clinical and postmortem findings of two Sinhalese patients, a 48-year-old husband and his 46-year-old wife, who both died following a massive attack by hornets 32 hours and 9 hours after the incidence respectively. At postmortem examination, both patients had pleural effusions, acute pulmonary oedema and red cell casts in their urine. Their coronary arteries and histology of myocardium were normal. CONCLUSION: Early recognition of acute pulmonary oedema in hornet stings is needed with implementation of crucial treatments to avert deaths. BioMed Central 2014-06-13 /pmc/articles/PMC4088920/ /pubmed/24929921 http://dx.doi.org/10.1186/1752-1947-8-188 Text en Copyright © 2014 Kularatne et al.; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/2.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License ( http://creativecommons.org/licenses/by/2.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly credited. The Creative Commons Public Domain Dedication waiver ( http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Case Report
Kularatne, Keerthi
Kannangare, Thamara
Jayasena, Ajith
Jayasekera, Aruni
Waduge, Roshitha
Weerakoon, Kosala
Kularatne, Senanayake AM
Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports
title Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports
title_full Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports
title_fullStr Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports
title_full_unstemmed Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports
title_short Fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (Vespa affinis) stings in Sri Lanka: two case reports
title_sort fatal acute pulmonary oedema and acute renal failure following multiple wasp/hornet (vespa affinis) stings in sri lanka: two case reports
topic Case Report
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4088920/
https://www.ncbi.nlm.nih.gov/pubmed/24929921
http://dx.doi.org/10.1186/1752-1947-8-188
work_keys_str_mv AT kularatnekeerthi fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports
AT kannangarethamara fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports
AT jayasenaajith fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports
AT jayasekeraaruni fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports
AT wadugeroshitha fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports
AT weerakoonkosala fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports
AT kularatnesenanayakeam fatalacutepulmonaryoedemaandacuterenalfailurefollowingmultiplewasphornetvespaaffinisstingsinsrilankatwocasereports