Cargando…

Nongenetic Determinants of Age at Menarche: A Systematic Review

Background. The acceleration of pubertal development is an important medical and social problem, as it may result in increased morbidity and mortality in later life. This systematic review summarizes relevant data about nongenetic factors, which contribute to age at menarche (AAM), and suggests thos...

Descripción completa

Detalles Bibliográficos
Autores principales: Yermachenko, Anna, Dvornyk, Volodymyr
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Hindawi Publishing Corporation 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4094877/
https://www.ncbi.nlm.nih.gov/pubmed/25050345
http://dx.doi.org/10.1155/2014/371583
_version_ 1782325912532942848
author Yermachenko, Anna
Dvornyk, Volodymyr
author_facet Yermachenko, Anna
Dvornyk, Volodymyr
author_sort Yermachenko, Anna
collection PubMed
description Background. The acceleration of pubertal development is an important medical and social problem, as it may result in increased morbidity and mortality in later life. This systematic review summarizes relevant data about nongenetic factors, which contribute to age at menarche (AAM), and suggests those which may be the most important. Methods. The available literature from 1980 till July 2013 was searched using PubMed and Google Scholar databases. Finally, 154 papers were selected for the analysis. Results. Environmental factors, which may affect AAM, vary in populations of different ethnicity. The prenatal, infancy, and early childhood periods are the most susceptible to these factors. Body weight, high animal protein intake, family stressors (e.g., single parenting), and physical activity seem to influence AAM in most populations. Conclusions. The data about influence of nongenetic factors on AAM are still inconsistent. The factors affecting prenatal and early childhood growth seem to have a larger effect on further sexual maturation. Further studies are needed in order to validate the association between other environmental determinants and AAM in different ethnical groups.
format Online
Article
Text
id pubmed-4094877
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Hindawi Publishing Corporation
record_format MEDLINE/PubMed
spelling pubmed-40948772014-07-21 Nongenetic Determinants of Age at Menarche: A Systematic Review Yermachenko, Anna Dvornyk, Volodymyr Biomed Res Int Review Article Background. The acceleration of pubertal development is an important medical and social problem, as it may result in increased morbidity and mortality in later life. This systematic review summarizes relevant data about nongenetic factors, which contribute to age at menarche (AAM), and suggests those which may be the most important. Methods. The available literature from 1980 till July 2013 was searched using PubMed and Google Scholar databases. Finally, 154 papers were selected for the analysis. Results. Environmental factors, which may affect AAM, vary in populations of different ethnicity. The prenatal, infancy, and early childhood periods are the most susceptible to these factors. Body weight, high animal protein intake, family stressors (e.g., single parenting), and physical activity seem to influence AAM in most populations. Conclusions. The data about influence of nongenetic factors on AAM are still inconsistent. The factors affecting prenatal and early childhood growth seem to have a larger effect on further sexual maturation. Further studies are needed in order to validate the association between other environmental determinants and AAM in different ethnical groups. Hindawi Publishing Corporation 2014 2014-06-23 /pmc/articles/PMC4094877/ /pubmed/25050345 http://dx.doi.org/10.1155/2014/371583 Text en Copyright © 2014 A. Yermachenko and V. Dvornyk. https://creativecommons.org/licenses/by/3.0/ This is an open access article distributed under the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited.
spellingShingle Review Article
Yermachenko, Anna
Dvornyk, Volodymyr
Nongenetic Determinants of Age at Menarche: A Systematic Review
title Nongenetic Determinants of Age at Menarche: A Systematic Review
title_full Nongenetic Determinants of Age at Menarche: A Systematic Review
title_fullStr Nongenetic Determinants of Age at Menarche: A Systematic Review
title_full_unstemmed Nongenetic Determinants of Age at Menarche: A Systematic Review
title_short Nongenetic Determinants of Age at Menarche: A Systematic Review
title_sort nongenetic determinants of age at menarche: a systematic review
topic Review Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4094877/
https://www.ncbi.nlm.nih.gov/pubmed/25050345
http://dx.doi.org/10.1155/2014/371583
work_keys_str_mv AT yermachenkoanna nongeneticdeterminantsofageatmenarcheasystematicreview
AT dvornykvolodymyr nongeneticdeterminantsofageatmenarcheasystematicreview