Cargando…
The Cross Talk between cGMP Signal Pathway and PKC in Pulmonary Endothelial Cell Angiogenesis
Angiogenic proliferation of vascular endothelial cells is believed to play an important role in pulmonary vascular remodeling in pulmonary arterial hypertension. In the present study, we found that c-GMP (cyclic guanosine monophosphate) inhibited the proliferation and tube formation of pulmonary vas...
Autores principales: | , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
MDPI
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4100147/ https://www.ncbi.nlm.nih.gov/pubmed/24914766 http://dx.doi.org/10.3390/ijms150610185 |
_version_ | 1782326621965910016 |
---|---|
author | Zeng, Zhen Li, Ying-Chuan Jiao, Zhi-Hua Yao, Jun Xue, Ying |
author_facet | Zeng, Zhen Li, Ying-Chuan Jiao, Zhi-Hua Yao, Jun Xue, Ying |
author_sort | Zeng, Zhen |
collection | PubMed |
description | Angiogenic proliferation of vascular endothelial cells is believed to play an important role in pulmonary vascular remodeling in pulmonary arterial hypertension. In the present study, we found that c-GMP (cyclic guanosine monophosphate) inhibited the proliferation and tube formation of pulmonary vascular endothelial cells induced by TGF-β1, and that this process was reversed by PKG (protein kinase G) inhibitor and PKC (protein kinase C) inhibitor. In addition, small interfering RNA (siRNA) targeting ERK also reduced cellular proliferation. Furthermore, western blotting showed that cGMP down-regulated the phosphorylation level of ERK1/2, which was reversed not only by PKG inhibitor but also by PKC inhibitor. Silencing different PKC isoforms showed that PKCΔ, PKCγ and PKCα were involved in ERK phosphorylation, suggesting that PKC kinases have a permissive action. Three subtypes, PKCΔ, PKCγ and PKCα are likely to be involved the phosphorylation suppression of ERK included cGMP. Taken together, these data suggest that ERK phosphorylation mediates the proliferation of pulmonary vascular endothelial cells, and PKC kinases have a permissive action in this process. |
format | Online Article Text |
id | pubmed-4100147 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | MDPI |
record_format | MEDLINE/PubMed |
spelling | pubmed-41001472014-07-16 The Cross Talk between cGMP Signal Pathway and PKC in Pulmonary Endothelial Cell Angiogenesis Zeng, Zhen Li, Ying-Chuan Jiao, Zhi-Hua Yao, Jun Xue, Ying Int J Mol Sci Article Angiogenic proliferation of vascular endothelial cells is believed to play an important role in pulmonary vascular remodeling in pulmonary arterial hypertension. In the present study, we found that c-GMP (cyclic guanosine monophosphate) inhibited the proliferation and tube formation of pulmonary vascular endothelial cells induced by TGF-β1, and that this process was reversed by PKG (protein kinase G) inhibitor and PKC (protein kinase C) inhibitor. In addition, small interfering RNA (siRNA) targeting ERK also reduced cellular proliferation. Furthermore, western blotting showed that cGMP down-regulated the phosphorylation level of ERK1/2, which was reversed not only by PKG inhibitor but also by PKC inhibitor. Silencing different PKC isoforms showed that PKCΔ, PKCγ and PKCα were involved in ERK phosphorylation, suggesting that PKC kinases have a permissive action. Three subtypes, PKCΔ, PKCγ and PKCα are likely to be involved the phosphorylation suppression of ERK included cGMP. Taken together, these data suggest that ERK phosphorylation mediates the proliferation of pulmonary vascular endothelial cells, and PKC kinases have a permissive action in this process. MDPI 2014-06-06 /pmc/articles/PMC4100147/ /pubmed/24914766 http://dx.doi.org/10.3390/ijms150610185 Text en © 2014 by the authors; licensee MDPI, Basel, Switzerland. This article is an open access article distributed under the terms and conditions of the Creative Commons Attribution license (http://creativecommons.org/licenses/by/3.0/). |
spellingShingle | Article Zeng, Zhen Li, Ying-Chuan Jiao, Zhi-Hua Yao, Jun Xue, Ying The Cross Talk between cGMP Signal Pathway and PKC in Pulmonary Endothelial Cell Angiogenesis |
title | The Cross Talk between cGMP Signal Pathway and PKC in Pulmonary Endothelial Cell Angiogenesis |
title_full | The Cross Talk between cGMP Signal Pathway and PKC in Pulmonary Endothelial Cell Angiogenesis |
title_fullStr | The Cross Talk between cGMP Signal Pathway and PKC in Pulmonary Endothelial Cell Angiogenesis |
title_full_unstemmed | The Cross Talk between cGMP Signal Pathway and PKC in Pulmonary Endothelial Cell Angiogenesis |
title_short | The Cross Talk between cGMP Signal Pathway and PKC in Pulmonary Endothelial Cell Angiogenesis |
title_sort | cross talk between cgmp signal pathway and pkc in pulmonary endothelial cell angiogenesis |
topic | Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4100147/ https://www.ncbi.nlm.nih.gov/pubmed/24914766 http://dx.doi.org/10.3390/ijms150610185 |
work_keys_str_mv | AT zengzhen thecrosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT liyingchuan thecrosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT jiaozhihua thecrosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT yaojun thecrosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT xueying thecrosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT zengzhen crosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT liyingchuan crosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT jiaozhihua crosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT yaojun crosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis AT xueying crosstalkbetweencgmpsignalpathwayandpkcinpulmonaryendothelialcellangiogenesis |