Cargando…

Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System

Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely use...

Descripción completa

Detalles Bibliográficos
Autores principales: Canale, Daniele, de Bragança, Ana Carolina, Gonçalves, Janaína Garcia, Shimizu, Maria Heloisa Massola, Sanches, Talita Rojas, Andrade, Lúcia, Volpini, Rildo Aparecido, Seguro, Antonio Carlos
Formato: Online Artículo Texto
Lenguaje:English
Publicado: Public Library of Science 2014
Materias:
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4105615/
https://www.ncbi.nlm.nih.gov/pubmed/25048368
http://dx.doi.org/10.1371/journal.pone.0103055
_version_ 1782327402662199296
author Canale, Daniele
de Bragança, Ana Carolina
Gonçalves, Janaína Garcia
Shimizu, Maria Heloisa Massola
Sanches, Talita Rojas
Andrade, Lúcia
Volpini, Rildo Aparecido
Seguro, Antonio Carlos
author_facet Canale, Daniele
de Bragança, Ana Carolina
Gonçalves, Janaína Garcia
Shimizu, Maria Heloisa Massola
Sanches, Talita Rojas
Andrade, Lúcia
Volpini, Rildo Aparecido
Seguro, Antonio Carlos
author_sort Canale, Daniele
collection PubMed
description Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely used component of antiretroviral regimens for HIV treatment, can induce renal injury. The aim of this study was to investigate the effects of VDD on TDF-induced nephrotoxicity. Wistar rats were divided into four groups: control, receiving a standard diet for 60 days; VDD, receiving a vitamin D-free diet for 60 days; TDF, receiving a standard diet for 60 days with the addition of TDF (50 mg/kg food) for the last 30 days; and VDD+TDF receiving a vitamin D-free diet for 60 days with the addition of TDF for the last 30 days. TDF led to impaired renal function, hyperphosphaturia, hypophosphatemia, hypertension and increased renal vascular resistance due to downregulation of the sodium-phosphorus cotransporter and upregulation of angiotensin II and AT1 receptor. TDF also increased oxidative stress, as evidenced by higher TBARS and lower GSH levels, and induced dyslipidemia. Association of TDF and VDD aggravated renovascular effects and TDF-induced nephrotoxicity due to changes in the redox state and involvement of RAAS.
format Online
Article
Text
id pubmed-4105615
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher Public Library of Science
record_format MEDLINE/PubMed
spelling pubmed-41056152014-07-23 Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System Canale, Daniele de Bragança, Ana Carolina Gonçalves, Janaína Garcia Shimizu, Maria Heloisa Massola Sanches, Talita Rojas Andrade, Lúcia Volpini, Rildo Aparecido Seguro, Antonio Carlos PLoS One Research Article Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely used component of antiretroviral regimens for HIV treatment, can induce renal injury. The aim of this study was to investigate the effects of VDD on TDF-induced nephrotoxicity. Wistar rats were divided into four groups: control, receiving a standard diet for 60 days; VDD, receiving a vitamin D-free diet for 60 days; TDF, receiving a standard diet for 60 days with the addition of TDF (50 mg/kg food) for the last 30 days; and VDD+TDF receiving a vitamin D-free diet for 60 days with the addition of TDF for the last 30 days. TDF led to impaired renal function, hyperphosphaturia, hypophosphatemia, hypertension and increased renal vascular resistance due to downregulation of the sodium-phosphorus cotransporter and upregulation of angiotensin II and AT1 receptor. TDF also increased oxidative stress, as evidenced by higher TBARS and lower GSH levels, and induced dyslipidemia. Association of TDF and VDD aggravated renovascular effects and TDF-induced nephrotoxicity due to changes in the redox state and involvement of RAAS. Public Library of Science 2014-07-21 /pmc/articles/PMC4105615/ /pubmed/25048368 http://dx.doi.org/10.1371/journal.pone.0103055 Text en © 2014 Canale et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited.
spellingShingle Research Article
Canale, Daniele
de Bragança, Ana Carolina
Gonçalves, Janaína Garcia
Shimizu, Maria Heloisa Massola
Sanches, Talita Rojas
Andrade, Lúcia
Volpini, Rildo Aparecido
Seguro, Antonio Carlos
Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System
title Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System
title_full Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System
title_fullStr Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System
title_full_unstemmed Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System
title_short Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System
title_sort vitamin d deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system
topic Research Article
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4105615/
https://www.ncbi.nlm.nih.gov/pubmed/25048368
http://dx.doi.org/10.1371/journal.pone.0103055
work_keys_str_mv AT canaledaniele vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT debragancaanacarolina vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT goncalvesjanainagarcia vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT shimizumariaheloisamassola vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT sanchestalitarojas vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT andradelucia vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT volpinirildoaparecido vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem
AT seguroantoniocarlos vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem