Cargando…
Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System
Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely use...
Autores principales: | , , , , , , , |
---|---|
Formato: | Online Artículo Texto |
Lenguaje: | English |
Publicado: |
Public Library of Science
2014
|
Materias: | |
Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4105615/ https://www.ncbi.nlm.nih.gov/pubmed/25048368 http://dx.doi.org/10.1371/journal.pone.0103055 |
_version_ | 1782327402662199296 |
---|---|
author | Canale, Daniele de Bragança, Ana Carolina Gonçalves, Janaína Garcia Shimizu, Maria Heloisa Massola Sanches, Talita Rojas Andrade, Lúcia Volpini, Rildo Aparecido Seguro, Antonio Carlos |
author_facet | Canale, Daniele de Bragança, Ana Carolina Gonçalves, Janaína Garcia Shimizu, Maria Heloisa Massola Sanches, Talita Rojas Andrade, Lúcia Volpini, Rildo Aparecido Seguro, Antonio Carlos |
author_sort | Canale, Daniele |
collection | PubMed |
description | Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely used component of antiretroviral regimens for HIV treatment, can induce renal injury. The aim of this study was to investigate the effects of VDD on TDF-induced nephrotoxicity. Wistar rats were divided into four groups: control, receiving a standard diet for 60 days; VDD, receiving a vitamin D-free diet for 60 days; TDF, receiving a standard diet for 60 days with the addition of TDF (50 mg/kg food) for the last 30 days; and VDD+TDF receiving a vitamin D-free diet for 60 days with the addition of TDF for the last 30 days. TDF led to impaired renal function, hyperphosphaturia, hypophosphatemia, hypertension and increased renal vascular resistance due to downregulation of the sodium-phosphorus cotransporter and upregulation of angiotensin II and AT1 receptor. TDF also increased oxidative stress, as evidenced by higher TBARS and lower GSH levels, and induced dyslipidemia. Association of TDF and VDD aggravated renovascular effects and TDF-induced nephrotoxicity due to changes in the redox state and involvement of RAAS. |
format | Online Article Text |
id | pubmed-4105615 |
institution | National Center for Biotechnology Information |
language | English |
publishDate | 2014 |
publisher | Public Library of Science |
record_format | MEDLINE/PubMed |
spelling | pubmed-41056152014-07-23 Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System Canale, Daniele de Bragança, Ana Carolina Gonçalves, Janaína Garcia Shimizu, Maria Heloisa Massola Sanches, Talita Rojas Andrade, Lúcia Volpini, Rildo Aparecido Seguro, Antonio Carlos PLoS One Research Article Vitamin D deficiency (VDD) is prevalent among HIV-infected individuals. Vitamin D has been associated with renal and cardiovascular diseases because of its effects on oxidative stress, lipid metabolism and renin-angiotensin-aldosterone system (RAAS). Tenofovir disoproxil fumarate (TDF), a widely used component of antiretroviral regimens for HIV treatment, can induce renal injury. The aim of this study was to investigate the effects of VDD on TDF-induced nephrotoxicity. Wistar rats were divided into four groups: control, receiving a standard diet for 60 days; VDD, receiving a vitamin D-free diet for 60 days; TDF, receiving a standard diet for 60 days with the addition of TDF (50 mg/kg food) for the last 30 days; and VDD+TDF receiving a vitamin D-free diet for 60 days with the addition of TDF for the last 30 days. TDF led to impaired renal function, hyperphosphaturia, hypophosphatemia, hypertension and increased renal vascular resistance due to downregulation of the sodium-phosphorus cotransporter and upregulation of angiotensin II and AT1 receptor. TDF also increased oxidative stress, as evidenced by higher TBARS and lower GSH levels, and induced dyslipidemia. Association of TDF and VDD aggravated renovascular effects and TDF-induced nephrotoxicity due to changes in the redox state and involvement of RAAS. Public Library of Science 2014-07-21 /pmc/articles/PMC4105615/ /pubmed/25048368 http://dx.doi.org/10.1371/journal.pone.0103055 Text en © 2014 Canale et al http://creativecommons.org/licenses/by/4.0/ This is an open-access article distributed under the terms of the Creative Commons Attribution License, which permits unrestricted use, distribution, and reproduction in any medium, provided the original author and source are properly credited. |
spellingShingle | Research Article Canale, Daniele de Bragança, Ana Carolina Gonçalves, Janaína Garcia Shimizu, Maria Heloisa Massola Sanches, Talita Rojas Andrade, Lúcia Volpini, Rildo Aparecido Seguro, Antonio Carlos Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System |
title | Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System |
title_full | Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System |
title_fullStr | Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System |
title_full_unstemmed | Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System |
title_short | Vitamin D Deficiency Aggravates Nephrotoxicity, Hypertension and Dyslipidemia Caused by Tenofovir: Role of Oxidative Stress and Renin-Angiotensin System |
title_sort | vitamin d deficiency aggravates nephrotoxicity, hypertension and dyslipidemia caused by tenofovir: role of oxidative stress and renin-angiotensin system |
topic | Research Article |
url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4105615/ https://www.ncbi.nlm.nih.gov/pubmed/25048368 http://dx.doi.org/10.1371/journal.pone.0103055 |
work_keys_str_mv | AT canaledaniele vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT debragancaanacarolina vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT goncalvesjanainagarcia vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT shimizumariaheloisamassola vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT sanchestalitarojas vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT andradelucia vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT volpinirildoaparecido vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem AT seguroantoniocarlos vitaminddeficiencyaggravatesnephrotoxicityhypertensionanddyslipidemiacausedbytenofovirroleofoxidativestressandreninangiotensinsystem |