BridgeDb app: unifying identifier mapping services for Cytoscape

The BridgeDb app for Cytoscape allows users to map and annotate identifiers of genes, proteins and metabolites in the context of biological networks. The app greatly simplifies the identifier mapping process in Cytoscape by providing a unified interface to different mapping resources and services. T...

Descripción completa

Detalles Bibliográficos
Autores principales: Gao, Jianjiong, Zhang, Chao, van Iersel, Martijn, Zhang, Li, Xu, Dong, Schultz, Nikolaus, R. Pico, Alexander
Formato: Online Artículo Texto
Lenguaje:English
Publicado: F1000Research 2014
Materias:
Software Tool
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4111116/
https://www.ncbi.nlm.nih.gov/pubmed/25110584
http://dx.doi.org/10.12688/f1000research.4521.1
_version_ 1782328068998692864
author Gao, Jianjiong
Zhang, Chao
van Iersel, Martijn
Zhang, Li
Xu, Dong
Schultz, Nikolaus
R. Pico, Alexander
author_facet Gao, Jianjiong
Zhang, Chao
van Iersel, Martijn
Zhang, Li
Xu, Dong
Schultz, Nikolaus
R. Pico, Alexander
author_sort Gao, Jianjiong
collection PubMed
description The BridgeDb app for Cytoscape allows users to map and annotate identifiers of genes, proteins and metabolites in the context of biological networks. The app greatly simplifies the identifier mapping process in Cytoscape by providing a unified interface to different mapping resources and services. The app also provides a programming interface via Cytoscape Commands that can be utilized for identifier mapping by other Cytoscape apps. In this article we provide a technical guide to the BridgeDb app for mapping identifiers in Cytoscape.
format Online
Article
Text
id pubmed-4111116
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher F1000Research
record_format MEDLINE/PubMed
spelling pubmed-41111162014-08-07 BridgeDb app: unifying identifier mapping services for Cytoscape Gao, Jianjiong Zhang, Chao van Iersel, Martijn Zhang, Li Xu, Dong Schultz, Nikolaus R. Pico, Alexander F1000Res Software Tool The BridgeDb app for Cytoscape allows users to map and annotate identifiers of genes, proteins and metabolites in the context of biological networks. The app greatly simplifies the identifier mapping process in Cytoscape by providing a unified interface to different mapping resources and services. The app also provides a programming interface via Cytoscape Commands that can be utilized for identifier mapping by other Cytoscape apps. In this article we provide a technical guide to the BridgeDb app for mapping identifiers in Cytoscape. F1000Research 2014-07-01 /pmc/articles/PMC4111116/ /pubmed/25110584 http://dx.doi.org/10.12688/f1000research.4521.1 Text en Copyright: © 2014 Gao J et al. http://creativecommons.org/licenses/by/4.0/ This is an open access article distributed under the terms of the Creative Commons Attribution Licence, which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. http://creativecommons.org/publicdomain/zero/1.0/ Data associated with the article are available under the terms of the Creative Commons Zero "No rights reserved" data waiver (CC0 1.0 Public domain dedication).
spellingShingle Software Tool
Gao, Jianjiong
Zhang, Chao
van Iersel, Martijn
Zhang, Li
Xu, Dong
Schultz, Nikolaus
R. Pico, Alexander
BridgeDb app: unifying identifier mapping services for Cytoscape
title BridgeDb app: unifying identifier mapping services for Cytoscape
title_full BridgeDb app: unifying identifier mapping services for Cytoscape
title_fullStr BridgeDb app: unifying identifier mapping services for Cytoscape
title_full_unstemmed BridgeDb app: unifying identifier mapping services for Cytoscape
title_short BridgeDb app: unifying identifier mapping services for Cytoscape
title_sort bridgedb app: unifying identifier mapping services for cytoscape
topic Software Tool
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4111116/
https://www.ncbi.nlm.nih.gov/pubmed/25110584
http://dx.doi.org/10.12688/f1000research.4521.1
work_keys_str_mv AT gaojianjiong bridgedbappunifyingidentifiermappingservicesforcytoscape
AT zhangchao bridgedbappunifyingidentifiermappingservicesforcytoscape
AT vanierselmartijn bridgedbappunifyingidentifiermappingservicesforcytoscape
AT zhangli bridgedbappunifyingidentifiermappingservicesforcytoscape
AT xudong bridgedbappunifyingidentifiermappingservicesforcytoscape
AT schultznikolaus bridgedbappunifyingidentifiermappingservicesforcytoscape
AT rpicoalexander bridgedbappunifyingidentifiermappingservicesforcytoscape

Ejemplares similares