Can up-skilling non-physician clinicians (NPCs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in Malawi? The ETATMBA Project

Detalles Bibliográficos
Autor principal: Ellard, David
Formato: Online Artículo Texto
Lenguaje:English
Publicado: BioMed Central 2014
Materias:
Oral Presentation
Acceso en línea:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4122851/
http://dx.doi.org/10.1186/1472-6963-14-S2-O36
_version_ 1782329403282292736
author Ellard, David
author_facet Ellard, David
author_sort Ellard, David
collection PubMed
description
format Online
Article
Text
id pubmed-4122851
institution National Center for Biotechnology Information
language English
publishDate 2014
publisher BioMed Central
record_format MEDLINE/PubMed
spelling pubmed-41228512014-08-11 Can up-skilling non-physician clinicians (NPCs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in Malawi? The ETATMBA Project Ellard, David BMC Health Serv Res Oral Presentation BioMed Central 2014-07-07 /pmc/articles/PMC4122851/ http://dx.doi.org/10.1186/1472-6963-14-S2-O36 Text en Copyright © 2014 Ellard; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated.
spellingShingle Oral Presentation
Ellard, David
Can up-skilling non-physician clinicians (NPCs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in Malawi? The ETATMBA Project
title Can up-skilling non-physician clinicians (NPCs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in Malawi? The ETATMBA Project
title_full Can up-skilling non-physician clinicians (NPCs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in Malawi? The ETATMBA Project
title_fullStr Can up-skilling non-physician clinicians (NPCs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in Malawi? The ETATMBA Project
title_full_unstemmed Can up-skilling non-physician clinicians (NPCs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in Malawi? The ETATMBA Project
title_short Can up-skilling non-physician clinicians (NPCs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in Malawi? The ETATMBA Project
title_sort can up-skilling non-physician clinicians (npcs) make a difference to practice and help towards reductions in maternal and neonatal mortality, in malawi? the etatmba project
topic Oral Presentation
url https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4122851/
http://dx.doi.org/10.1186/1472-6963-14-S2-O36
work_keys_str_mv AT ellarddavid canupskillingnonphysiciancliniciansnpcsmakeadifferencetopracticeandhelptowardsreductionsinmaternalandneonatalmortalityinmalawitheetatmbaproject

Ejemplares similares