Cargando…
Effects of ethnicity on the quality of family planning services in Lima, Peru
| Autores principales: | , , , , , , , , |
|---|---|
| Formato: | Online Artículo Texto |
| Lenguaje: | English |
| Publicado: |
BioMed Central
2014
|
| Materias: | |
| Acceso en línea: | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4122884/ http://dx.doi.org/10.1186/1472-6963-14-S2-P95 |
| _version_ | 1782329409936556032 |
|---|---|
| author | Planas, Maria Elena García, Patricia Bustelo, Monserrat Cárcamo, Cesar Martinez, Sebastian Nopo, Hugo Rodriguez, Julio Merino, Maria-Fernanda Morrison, Andrew |
| author_facet | Planas, Maria Elena García, Patricia Bustelo, Monserrat Cárcamo, Cesar Martinez, Sebastian Nopo, Hugo Rodriguez, Julio Merino, Maria-Fernanda Morrison, Andrew |
| author_sort | Planas, Maria Elena |
| collection | PubMed |
| description | |
| format | Online Article Text |
| id | pubmed-4122884 |
| institution | National Center for Biotechnology Information |
| language | English |
| publishDate | 2014 |
| publisher | BioMed Central |
| record_format | MEDLINE/PubMed |
| spelling | pubmed-41228842014-08-11 Effects of ethnicity on the quality of family planning services in Lima, Peru Planas, Maria Elena García, Patricia Bustelo, Monserrat Cárcamo, Cesar Martinez, Sebastian Nopo, Hugo Rodriguez, Julio Merino, Maria-Fernanda Morrison, Andrew BMC Health Serv Res Poster Presentation BioMed Central 2014-07-07 /pmc/articles/PMC4122884/ http://dx.doi.org/10.1186/1472-6963-14-S2-P95 Text en Copyright © 2014 Planas et al; licensee BioMed Central Ltd. http://creativecommons.org/licenses/by/4.0 This is an Open Access article distributed under the terms of the Creative Commons Attribution License (http://creativecommons.org/licenses/by/4.0), which permits unrestricted use, distribution, and reproduction in any medium, provided the original work is properly cited. The Creative Commons Public Domain Dedication waiver (http://creativecommons.org/publicdomain/zero/1.0/) applies to the data made available in this article, unless otherwise stated. |
| spellingShingle | Poster Presentation Planas, Maria Elena García, Patricia Bustelo, Monserrat Cárcamo, Cesar Martinez, Sebastian Nopo, Hugo Rodriguez, Julio Merino, Maria-Fernanda Morrison, Andrew Effects of ethnicity on the quality of family planning services in Lima, Peru |
| title | Effects of ethnicity on the quality of family planning services in Lima, Peru |
| title_full | Effects of ethnicity on the quality of family planning services in Lima, Peru |
| title_fullStr | Effects of ethnicity on the quality of family planning services in Lima, Peru |
| title_full_unstemmed | Effects of ethnicity on the quality of family planning services in Lima, Peru |
| title_short | Effects of ethnicity on the quality of family planning services in Lima, Peru |
| title_sort | effects of ethnicity on the quality of family planning services in lima, peru |
| topic | Poster Presentation |
| url | https://www.ncbi.nlm.nih.gov/pmc/articles/PMC4122884/ http://dx.doi.org/10.1186/1472-6963-14-S2-P95 |
| work_keys_str_mv | AT planasmariaelena effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu AT garciapatricia effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu AT bustelomonserrat effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu AT carcamocesar effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu AT martinezsebastian effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu AT nopohugo effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu AT rodriguezjulio effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu AT merinomariafernanda effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu AT morrisonandrew effectsofethnicityonthequalityoffamilyplanningservicesinlimaperu |